Record in detail


General Info

  • lamp_id:L12A009591
  • Name:
  • FullName:
  • Source:
  • Mass:4890.7 Da
  • Sequence Length:44 aa
  • Isoelectric Point:10.03
  • Activity:Antibacterial,AntiGram_p
  • Sequence
        MVRARRGCGCPLNQGACHRHCKSIGRRGGYCAGFLKQTCTCYRN
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A09591|    From 1 To 44 E-value: 1e-20 Score: 90.1
        MVRARRGCGCPLNQGACHRHCKSIGRRGGYCAGFLKQTCTCYRN
  • 2. L05ADEF535    From 1 To 38 E-value: 3e-17 Score: 79
        GCGCPLNQGACHRHCKSIGRRGGYCAGFLKQTCTCYRN
  • 3. L05ADEF394    From 10 To 51 E-value: 1e-16 Score: 76.6
        VRVRRGFGCPLNQGACHNHCRSIGRRGGYCAGIIKQTCTCYR
  • 4. L12A01314|    From 9 To 51 E-value: 2e-16 Score: 75.9
        LRVRRGFGCPLNQGACHRHCRSIRRRGGYCSGIIKQTCTCYRN
  • 5. L03A000241    From 32 To 74 E-value: 7e-16 Score: 74.3
        LRVRRGFGCPLNQGACHNHCRSIRRRGGYCSGIIKQTCTCYRN

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Bacilus subtilis NCIMB 8024  -:  NA -  ( )  
  •   2  Target:  Staphylococcus epidermidis ATCC 12228  -:  NA -  ( )  
  •   3  Target:  Staphylococcus aureus SH1000  -:  NA -  ( )  
  •   4  Target:  Escherichia coli JM109  -:  NA -  ( )  
  •   5  Target:  Klebsiella pneumoniae NCTC 13439  -:  NA -  ( )  
  •   6  Target:  Pseudomonas aeruginosa NCIMB 8295  -:  NA -  ( )  
  •   7  Target:  Candida albicans ATCC 10231  -:  NA -  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: