Record in detail


General Info

  • lamp_id:L12A009593
  • Name:
  • FullName:
  • Source:
  • Mass:8615.2 Da
  • Sequence Length:79 aa
  • Isoelectric Point:8.03
  • Activity:Antimicrobial
  • Sequence
        MVRVNSLRSALYLIVLILFVQLTCFSDARVMDVDLSRAFLPLTGIGCGESCVWIPCVSAAIGCSCSNKICYRNGIIPEK
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A09593|    From 1 To 79 E-value: 9.99967e-42 Score: 159
        MVRVNSLRSALYLIVLILFVQLTCFSDARVMDVDLSRAFLPLTGIGCGESCVWIPCVSAAIGCSCSNKICYRNGIIPEK
  • 2. L12A06234|    From 1 To 79 E-value: 2e-30 Score: 122
        MAGVNSLRSALYLIILILFVQLTNFQESRVMAVELSRVFLPLSGVPCGESCVWMYCISAAMGCSCRNKVCYRNEIIQEK
  • 3. L12A06233|    From 1 To 79 E-value: 1e-29 Score: 120
        MAGVNSLRSALYLIILILFVQLTNFQESRVMAVELSRVFLPLSGIPCGESCVWMYCITATMGCSCRNKVCYKNEIIQEK
  • 4. L12A02897|    From 1 To 30 E-value: 0.0000000000007 Score: 64.3
        GIGCGESCVWIPCVSAAIGCSCSNKICYRN
  • 5. L13A027860    From 1 To 29 E-value: 0.00000000003 Score: 58.9
        CGESCVWIPCISAALGCSCKNKVCYRNGI

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Bacilus subtilis NCIMB 8024  MIC:  8 μg/ml  ( )  
  •   2  Target:  Staphylococcus epidermidis ATCC 12228  MIC:  16 μg/ml  ( )  
  •   3  Target:  Staphylococcus aureus SH1000  MIC:  16 μg/ml  ( )  
  •   4  Target:  Escherichia coli JM109  MIC:  64 μg/ml  ( )  
  •   5  Target:  Klebsiella pneumoniae NCTC 13439  MIC:  128 μg/ml  ( )  
  •   6  Target:  Pseudomonas aeruginosa NCIMB 8295  MIC:  256 μg/ml  ( )  
  •   7  Target:  Candida albicans ATCC 10231  MIC:  128 μg/ml  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: