Record in detail


General Info

  • lamp_id:L12A009669
  • Name:
  • FullName:
  • Source:
  • Mass:5179.9 Da
  • Sequence Length:43 aa
  • Isoelectric Point:8.61
  • Activity:Antibacterial,AntiGram_p,Antiviral
  • Sequence
        NDPEMQYWTCGYRGLCRRFCHAQEYIVGHHGCPRRYRCCAVRS
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A09669|    From 1 To 43 E-value: 3e-21 Score: 92.4
        NDPEMQYWTCGYRGLCRRFCHAQEYIVGHHGCPRRYRCCAVRS
  • 2. L12A01316|    From 3 To 44 E-value: 2e-18 Score: 83.2
        KDPVMQYWTCGYRGLCRRFCYAQEYIIGHHGCPRRYRCCAMR
  • 3. L12A08993|    From 1 To 38 E-value: 3e-17 Score: 79
        MQYWTCGYRGLCRRFCYAQEYIVGHHGCPRRYRCCAVR
  • 4. L12A01013|    From 1 To 42 E-value: 0.00000000000004 Score: 68.6
        DDTKVQGWTCGYRGACRKYCYAQEYMVGYHGCPRRLRCCALR
  • 5. L12A09670|    From 1 To 42 E-value: 0.00000000000005 Score: 68.2
        NDTDVQRWTCGYRGLCRKHCYAREYMIGYRGCPRRYRCCALR

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Pseudomonas aeruginosa PAO1  MIC:  4 μM  ( )  
  •   2  Target:  Pseudomonas aeruginosa PAO1  MBC:  0.5 μM  ( )  
  •   3  Target:  Staphylococcus aureus USA 300  MIC:  2.5 μM  ( )  
  •   4  Target:  Staphylococcus aureus USA 300  MBC:  1 μM  ( )  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: