Record in detail


General Info

  • lamp_id:L12A009670
  • Name:
  • FullName:
  • Source:
  • Mass:5298.1 Da
  • Sequence Length:43 aa
  • Isoelectric Point:9.38
  • Activity:Antimicrobial
  • Sequence
        NDTDVQRWTCGYRGLCRKHCYAREYMIGYRGCPRRYRCCALRF
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A09670|    From 1 To 43 E-value: 1e-20 Score: 89.7
        NDTDVQRWTCGYRGLCRKHCYAREYMIGYRGCPRRYRCCALRF
  • 2. L12A12182|    From 2 To 43 E-value: 5e-16 Score: 74.7
        DTEIQGWTCGSRGLCRKHCYAQEHTVGYHGCPRRYRCCALRF
  • 3. L12A01013|    From 1 To 43 E-value: 7e-16 Score: 74.3
        DDTKVQGWTCGYRGACRKYCYAQEYMVGYHGCPRRLRCCALRF
  • 4. L13A022408    From 2 To 43 E-value: 0.000000000000001 Score: 73.6
        DTGIQGWTCGSRGLCRKHCYAQEHTVGYHGCPRRYRCCALRF
  • 5. L12A01316|    From 3 To 45 E-value: 0.00000000000002 Score: 69.3
        KDPVMQYWTCGYRGLCRRFCYAQEYIIGHHGCPRRYRCCAMRF

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Pseudomonas aeruginosa PAO1  MIC:  8 μM  ( )  
  •   2  Target:  Pseudomonas aeruginosa PAO1  MBC:  2 μM  ( )  
  •   3  Target:  Staphylococcus aureus USA 300  MIC:  8 μM  ( )  
  •   4  Target:  Staphylococcus aureus USA 300  MBC:  0.5 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: