Record in detail


General Info

  • lamp_id:L12A009678
  • Name:
  • FullName:
  • Source:
  • Mass:4619.1 Da
  • Sequence Length:38 aa
  • Isoelectric Point:11.08
  • Activity:Antibacterial
  • Sequence
        NEYHGFVDKANNENKRKKQQGRDDFVVKPNNFANRRRK
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:dbAMP  dbAMP_09678

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000325    From 1 To 38 E-value: 1e-16 Score: 77
        NEYHGFVDKANNENKRKKQQGRDDFVVKPNNFANRRRK
  • 2. L12A09678|    From 1 To 38 E-value: 2e-16 Score: 76.6
        NEYHGFVDKANNENKRKKQQGRDDFVVKPNNFANRRRK
  • 3. L13A019267    From 1 To 38 E-value: 2e-16 Score: 76.3
        NEYHGFVDKANNENKRKKQQGRDDFVVKPNNFANRRRK
  • 4. L11A011555    From 2 To 23 E-value: 9.6 Score: 20.8
        EYWGKCTKAENRCKYKNDKGKD

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli ATCC 25922  -:  NA -  ( )  
  •   2  Target:  Staphylococcus aureus ATCC 29213  -:  NA -  ( )  
  •   3  Target:  Pseudomonas aeruginosa ATCC 27853  -:  NA -  ( )  
  •   4  Target:  Enterococcus faecalis ATCC 29212  -:  NA -  ( )  
  •   5  Target:  Streptococcus pneumoniae ATCC 49619  -:  NA -  ( )  
  •   6  Target:  Streptococcus pyogenes ATCC 19615  -:  NA -  ( )  
  •   7  Target:  Streptococcus agalactiae ATCC 12386  -:  NA -  ( )  
  •   8  Target:  Candida parapsilosis ATCC 22019  -:  NA -  ( )  
  •   9  Target:  Candida krusei ATCC 6258  -:  NA -  ( )  
  •   10  Target:  Human lung carcinoma A549  -:  NA -  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: