Record in detail


General Info

  • lamp_id:L12A009836
  • Name:
  • FullName:
  • Source:
  • Mass:7190.5 Da
  • Sequence Length:60 aa
  • Isoelectric Point:9.47
  • Activity:Antimicrobial
  • Sequence
        NWKIQRCWEKDIGHCRKRCFQNERYKLLCKNKLTCCIPITAQLSTPKPPPRVIYIEDITV
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A09836|    From 1 To 60 E-value: 4e-31 Score: 124
        NWKIQRCWEKDIGHCRKRCFQNERYKLLCKNKLTCCIPITAQLSTPKPPPRVIYIEDITV
  • 2. L12A04401|    From 1 To 61 E-value: 1e-17 Score: 80.5
        GWTVERCWKNNIGHCRKRCFHVERYKLLCMNKLTCCIPIKEDHGYTKTPPRLVPFEEEITI
  • 3. L12A01523|    From 1 To 57 E-value: 2e-16 Score: 75.9
        ERCWKNNIGHCRKRCFHVERYKLLCMNKLTCCIPIKEDHGYTKTPPRLVPFEEEITI
  • 4. L12A02368|    From 5 To 64 E-value: 8e-16 Score: 74.3
        GWFVERCWKNNIGHCRKRCFHIERYKLLCMNKLSCCIPLTSDDPYTQWPIHPTLLEDVTA
  • 5. L12A04322|    From 1 To 61 E-value: 0.000000000000002 Score: 73.2
        GWETERCWKDNIGHCRKRCFHVERYKLLCMNKLICCIPIKDDHGYTKMPPRLEPIKEEITT

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Staphylococcus aureus USA 300  MIC:  >50 μM  ( )  
  •   2  Target:  Pseudomonas aeruginosa PAO1  MIC:  >50 μM  ( )  
  •   3  Target:  Escherichia coli ATCC 25922  MIC:  >50 μM  ( )  
  •   4  Target:  Klebsiella pneumoniae  MIC:  >50 μM  ( )  
  •   5  Target:  Candida albicans ATCC 10231  MIC:  >25 μM  ( )  
  •   6  Target:  Candida glabrata ATCC 2001  MIC:  >25 μM  ( )  
  •   7  Target:  Candida tropicalis ATCC 13803  MIC:  >25 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: