Record in detail


General Info

  • lamp_id:L12A009837
  • Name:
  • FullName:
  • Source:
  • Mass:4671.6 Da
  • Sequence Length:41 aa
  • Isoelectric Point:9.66
  • Activity:Antimicrobial
  • Sequence
        NWMVKKCANKSGNCRSKCRTGELQIKPHNGMCIKEKMCCVL
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A09837|    From 1 To 41 E-value: 6e-19 Score: 84.7
        NWMVKKCANKSGNCRSKCRTGELQIKPHNGMCIKEKMCCVL
  • 2. L12A06094|    From 5 To 45 E-value: 0.000000000001 Score: 63.9
        SWYVRKCANKTGNCRSMCRVGETAIQPATGICPKEKMCCIL
  • 3. L12A11347|    From 1 To 41 E-value: 0.000000000001 Score: 63.5
        SWYVRKCANKTGNCRSMCRVGETAIQPATGICPKEKMCCIL
  • 4. L12A09849|    From 1 To 41 E-value: 0.000000000001 Score: 63.5
        NWYVRKCANKTGNCRSTCRNGERVINPPTGMCSKEKLCCIL
  • 5. L12A09838|    From 1 To 41 E-value: 0.000000000002 Score: 62.8
        NWNVRKCANKAGNCRSTCRNGEKMINPPTGMCSKEKLCCIL

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Staphylococcus aureus USA 300  MIC:  >50 μM  ( )  
  •   2  Target:  Pseudomonas aeruginosa PAO1  MIC:  >50 μM  ( )  
  •   3  Target:  Escherichia coli ATCC 25922  MIC:  >50 μM  ( )  
  •   4  Target:  Klebsiella pneumoniae  MIC:  >50 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: