Record in detail


General Info

  • lamp_id:L12A009842
  • Name:
  • FullName:
  • Source:
  • Mass:4606.4 Da
  • Sequence Length:40 aa
  • Isoelectric Point:10.31
  • Activity:Antimicrobial
  • Sequence
        NWYLKKCANKSGNCRKKCRNGEMQTQPSTSRCPRAKICCI
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A09842|    From 1 To 40 E-value: 2e-18 Score: 82.8
        NWYLKKCANKSGNCRKKCRNGEMQTQPSTSRCPRAKICCI
  • 2. L12A06094|    From 5 To 44 E-value: 0.00000000004 Score: 58.5
        SWYVRKCANKTGNCRSMCRVGETAIQPATGICPKEKMCCI
  • 3. L12A09848|    From 1 To 40 E-value: 0.00000000005 Score: 58.2
        NWYVRKCANKLGTCRKTCRKGEYQTDPATGKCSIGKLCCI
  • 4. L12A11347|    From 1 To 40 E-value: 0.00000000005 Score: 58.2
        SWYVRKCANKTGNCRSMCRVGETAIQPATGICPKEKMCCI
  • 5. L12A12129|    From 1 To 39 E-value: 0.0000000002 Score: 56.2
        WYVRKCANKLGTCRKTCRKGEYQTDPATGKCSIGKLCCI

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli DSM 30083  MIC:  2-5 μM  ( )  
  •   2  Target:  Acinetobacter baumannii DSM 30007  MIC:  5-9 μM  ( )  
  •   3  Target:  Pseudomonas aeruginosa DSM 50071  MIC:  18-37 μM  ( )  
  •   4  Target:  Staphylococcus aureus DSM 20231  MIC:  2-5 μM  ( )  
  •   5  Target:  Staphylococcus aureus ATCC 43300  MIC:  2 μM  ( )  
  •   6  Target:  Bacillus subtilis DSM 402  MIC:  0.6-1.1 μM  ( )  
  •   7  Target:  Human breast adenocarcinoma MCF-7  IC50:  4.7 μM  ( )  
  •   8  Target:  Human colon adenocarcinoma HT29  IC50:  4.5 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: