Record in detail


General Info

  • lamp_id:L12A009954
  • Name:
  • FullName:
  • Source:
  • Mass:4490 Da
  • Sequence Length:40 aa
  • Isoelectric Point:3.99
  • Activity:Antimicrobial
  • Sequence
        PMKKSLLLLFFFGTISLSLCQQERDADEEEGSENGAEDIK
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A09954|    From 1 To 40 E-value: 5e-18 Score: 81.6
        PMKKSLLLLFFFGTISLSLCQQERDADEEEGSENGAEDIK
  • 2. L12A09951|    From 1 To 40 E-value: 2e-16 Score: 75.9
        PMKKSLCLLFFLGTISLSLCEQERDADEEEGSENGAEDIK
  • 3. L12A11461|    From 2 To 40 E-value: 0.000000000000008 Score: 70.9
        LKKPLLVLFFLGTISLSLCEQERDADEEEGSENGAEDIK
  • 4. L12A11462|    From 2 To 40 E-value: 0.0000000000001 Score: 67
        LKKPLLVLFFLGTISLSLCEQERSADEEEGSENGTEDIK
  • 5. L12A06957|    From 3 To 42 E-value: 0.000000000001 Score: 63.2
        PMKKSLLVLFFFGTISLSFCQEERNADEEDGGEVTEEEVK

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Micrococcus luteus DSM 20030  MIC:  4 μM  ( )  
  •   2  Target:  Escherichia coli D31  -:  NA -  ( )  
  •   3  Target:  Pseudomonas aeruginosa DSM 50071  -:  NA -  ( )  
  •   4  Target:  Staphylococcus aureus DSM 2569  MIC:  8 μM  ( )  
  •   5  Target:  Listeria grayi DSM 20601  -:  NA -  ( )  
  •   6  Target:  Listeria fleischmannii DSM 24998  MIC:  15 μM  ( )  
  •   7  Target:  Listeria monocytogenes DSM 20600  MIC:  15 μM  ( )  
  •   8  Target:  Fusarium culmorum  -:  NA -  ( )  
  •   9  Target:  Fusarium graminearum 8/1  -:  NA -  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: