Record in detail
General Info
- lamp_id:L12A009986
- Name:
- FullName:
- Source:
- Mass:3854.5 Da
- Sequence Length:35 aa
- Isoelectric Point:8.39
- Activity:Antimicrobial
- Sequence
PQREMLFCRGGSCHFGGCPFHLVKVGSCFGFRSCC - Function:
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ6014
- 2 Database:dbAMP dbAMP_09986
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L12A09986| From 1 To 35 E-value: 0.000000000000004 Score: 71.6
PQREMLFCRGGSCHFGGCPFHLVKVGSCFGFRSCC - 2. L12A07930| From 24 To 58 E-value: 0.000000000000005 Score: 71.2
PRREMIFCRGGSCHFGGCPFHLVKVGSCFGFRSCC - 3. L12A08315| From 24 To 58 E-value: 0.000000000000006 Score: 71.2
PRREMIFCRGGSCHFGGCPFHLIKVGSCFGFRSCC - 4. L12A08314| From 24 To 58 E-value: 0.000000000000008 Score: 70.9
PRREMLFCRGGSCHFGGCPFHLVKVGKCFGFRSCC - 5. L12A10001| From 1 To 35 E-value: 0.00000000000001 Score: 70.1
PRREMLFCRGGSCHFGGCPFHLVKVGSCFGFRSCC
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
- 1 Target: Staphylococcus aureus ATCC 25923 MIC: 1.25±0.3 μM ( )
- 2 Target: Staphylococcus aureus ATCC 29213 MIC: 2.5±0.4 μM ( )
- 3 Target: Staphylococcus aureus ATCC 700699 MIC: 2.5±0.4 μM ( )
- 4 Target: Staphylococcus aureus ATCC 33592 MIC: 1.25±0.3 μM ( )
- 5 Target: Staphylococcus aureus ATCC BAA-44 MIC: 1.25±0.3 μM ( )
- 6 Target: Staphylococcus aureus ATCC 700698 MIC: 2.5±0.4 μM ( )
- 7 Target: Staphylococcus aureus ATCC 1708 MIC: 2.5±0.4 μM ( )
- 8 Target: Pseudomonas aeruginosa ATCC BAA-427 MIC: 7.0±1.0 μM ( )
- 9 Target: Bacillus subtilis ATCC 6633 MIC: 8.5±1.2 μM ( )
- 10 Target: Klebsiella pneumoniae ATCC 27736 MIC: 3.2±0.4 μM ( )
- 11 Target: Escherichia coli ATCC 25922 MIC: 3.5±0.4 μM ( )
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
No references found on LAMP database
Comments
- Comments
No comments found on LAMP database