Record in detail


General Info

  • lamp_id:L12A010037
  • Name:
  • FullName:
  • Source:
  • Mass:4572.2 Da
  • Sequence Length:42 aa
  • Isoelectric Point:9.55
  • Activity:Antimicrobial
  • Sequence
        QAQALLPIASYAGLAVSPPVFAALVTAYGVYALYRYNIRREN
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A10037|    From 1 To 42 E-value: 2e-18 Score: 82.4
        QAQALLPIASYAGLAVSPPVFAALVTAYGVYALYRYNIRREN
  • 2. L12A10040|    From 1 To 42 E-value: 0.000000000000008 Score: 70.9
        QAQALLPIASYAGLTVSAPVFAALVTVYGAYALYRYNIRRRE
  • 3. L12A10039|    From 1 To 42 E-value: 0.00000000000001 Score: 70.1
        QAQALLPIASYAGLTVSAPVFAALVTVYGAYALYRYNIRRRE
  • 4. L12A10038|    From 1 To 42 E-value: 0.00000000000008 Score: 67.4
        QAQALLPIASYAGLTVSAPVFAALVTVYGAYALYGYNIRRRE
  • 5. L12A10042|    From 1 To 42 E-value: 0.000000000009 Score: 60.5
        QAQILLPIASYAGLTVTAPVFAALVAAYGIYAVTRYAIRKRR

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Enterococcus faecalis  MIC:  2 μg/ml  ( )  
  •   2  Target:  Rhodococcus equi ATCC 6939  MIC:  2 μg/ml  ( )  
  •   3  Target:  Staphylococcus aureus ATCC 6538  MIC:  2 μg/ml  ( )  
  •   4  Target:  Staphylococcus epidermidis  MIC:  2 μg/ml  ( )  
  •   5  Target:  Streptococcus pyogenes  MIC:  4 μg/ml  ( )  
  •   6  Target:  Escherichia coli ATCC 8739  MIC:  8 μg/ml  ( )  
  •   7  Target:  Pseudomonas aeruginosa  MIC:  8 μg/ml  ( )  
  •   8  Target:  Candida albicans ATCC 10231  MIC:  128 μg/ml  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: