Record in detail


General Info

  • lamp_id:L12A010234
  • Name:
  • FullName:
  • Source:
  • Mass:7649.4 Da
  • Sequence Length:65 aa
  • Isoelectric Point:6.72
  • Activity:Antimicrobial
  • Sequence
        QQEQDEHQMEIETPQQNEHSTETTETQGQTNPLAFFRTKRQSHLSLCRYCCNCCRNKGCGYCCKF
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A07776|    From 29 To 93 E-value: 9e-35 Score: 137
        QQEQDEHQMEIETPQQNEHSTETTETQGQTNPLAFFRTKRQSHLSLCRYCCNCCRNKGCGYCCKF
  • 2. L12A10234|    From 1 To 65 E-value: 9e-34 Score: 133
        QQEQDEHQMEIETPQQNEHSTETTETQGQTNPLAFFRTKRQSHLSLCRYCCNCCRNKGCGYCCKF
  • 3. L12A01558|    From 3 To 42 E-value: 0.000000000000002 Score: 72.8
        TPEQSNPLALFRSKRQSHLSMCRYCCKCCRNKGCGFCCKF
  • 4. L12A01532|    From 1 To 54 E-value: 0.00000000000004 Score: 68.6
        ESEAPQENQHLTETS--QEQTNPLAFFRVKRQSHLSLCRYCCNCCRNKGCGYCCKF
  • 5. L12A07980|    From 29 To 86 E-value: 0.0000000000002 Score: 66.6
        QQTEDEHHVESGTP-----PTETS--QEQTNPLAFFRVKRQSHLSLCRYCCNCCRNKGCGYCCKF

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli TOP 10  MBC:  >20 μM  ( )  
  •   2  Target:  Staphylococcus aureus  MBC:  >20 μM  ( )  
  •   3  Target:  Vibrio parahaemolyticus  MBC:  >20 μM  ( )  
  •   4  Target:  Pichia pastoris  MBC:  >20 μM  ( )  
  •   5  Target:  Cryptocaryon irritans  -:  NA -  ( )  
  •   6  Target:  Cryptocaryon irritans  30-50% Lys:  10 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: