Record in detail


General Info

  • lamp_id:L12A010242
  • Name:
  • FullName:
  • Source:
  • Mass:5628.7 Da
  • Sequence Length:45 aa
  • Isoelectric Point:10.1
  • Activity:Antimicrobial
  • Sequence
        QRCWNLYGKCRHRCSRKERVYVYCLNNKMCCVKPKYQPKEKWGPF
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A10242|    From 1 To 45 E-value: 7e-22 Score: 94
        QRCWNLYGKCRHRCSRKERVYVYCLNNKMCCVKPKYQPKEKWGPF
  • 2. L01A003515    From 3 To 47 E-value: 1e-20 Score: 89.7
        QRCWNLYGKCRHRCSKKERVYVYCLNNKMCCVKPKYQPKEKWWPF
  • 3. L05ADEF224    From 23 To 67 E-value: 2e-20 Score: 89.7
        QRCWNLYGKCRHRCSKKERVYVYCLNNKMCCVKPKYQPKEKWWPF
  • 4. L12A10241|    From 1 To 45 E-value: 2e-20 Score: 89.7
        QRCWNLYGKCRHRCSKKERVYVYCLNNKMCCVKPKYQPKEKWWPF
  • 5. L12A04179|    From 3 To 47 E-value: 3e-20 Score: 89
        QRCWNLYGKCRHRCSKKERVYVYCLNNKMCCVKPRYQPKEKWWPF

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Bacillus subtilis ATCC 6633  62% inhibi:  10 μM  ( )  
  •   2  Target:  Bacillus subtilis ATCC 6633  99% inhibi:  20 μM  ( )  
  •   3  Target:  Bacillus subtilis ATCC 6633  100% inhib:  30 μM  ( )  
  •   4  Target:  Listeria monocytogenes ATCC 19115  100% inhib:  10-30 μM  ( )  
  •   5  Target:  Micrococcus luteus ATCC 9341  100% inhib:  10-30 μM  ( )  
  •   6  Target:  Staphylococcus epidermidis ATCC 12228  98% inhibi:  10 μM  ( )  
  •   7  Target:  Staphylococcus epidermidis ATCC 12228  100% inhib:  20-30 μM  ( )  
  •   8  Target:  Bacillus cereus ATCC 10876  64% inhibi:  10 μM  ( )  
  •   9  Target:  Bacillus cereus ATCC 10876  98% inhibi:  20-30 μM  ( )  
  •   10  Target:  Staphylococcus aureus ATCC 25923  98% inhibi:  10-30 μM  ( )  
  •   11  Target:  Salmonella typhimurium ATCC 14028  98% inhibi:  10-30 μM  ( )  
  •   12  Target:  Vibrio parahaemolyticus ISP 72-01  60% inhibi:  10 μM  ( )  
  •   13  Target:  Vibrio parahaemolyticus ISP 72-01  100% inhib:  20-30 μM  ( )  
  •   14  Target:  Escherichia coli ATCC 25922  100% inhib:  10-30 μM  ( )  
  •   15  Target:  Salmonella enteritidis ISP 1833-99  100% inhib:  10-30 μM  ( )  
  •   16  Target:  Aeromonas hydrophila ATCC 7966  37% inhibi:  10 μM  ( )  
  •   17  Target:  Aeromonas hydrophila ATCC 7966  49% inhibi:  20 μM  ( )  
  •   18  Target:  Aeromonas hydrophila ATCC 7966  62% inhibi:  30 μM  ( )  
  •   19  Target:  Pseudomonas aeruginosa ATCC 27853  50% inhibi:  20 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: