Record in detail
General Info
- lamp_id:L12A010273
- Name:
- FullName:
- Source:
- Mass:3412.9 Da
- Sequence Length:32 aa
- Isoelectric Point:7.73
- Activity:Antimicrobial
- Sequence
QSISCAESCVWIPCATSLIGCSCVNSRCIYSK - Function:
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ4990
- 2 Database:dbAMP dbAMP_10273
- 3 Database:DRAMP DRAMP00321
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L12A10273| From 1 To 32 E-value: 0.000000000001 Score: 63.5
QSISCAESCVWIPCATSLIGCSCVNSRCIYSK - 2. L12A05611| From 65 To 93 E-value: 0.000004 Score: 42
VPCGESCVWIPCLTSIVGCSCKNNVCTLN - 3. L13A028342 From 3 To 32 E-value: 0.000009 Score: 40.8
SVPCGESCVFIPCITSLAGCSCKNKVCYYD - 4. L02A001139 From 2 To 31 E-value: 0.00001 Score: 40.4
SIPCAESCVYIPCFTGIAGCSCKNKVCYYN - 5. L02A001140 From 2 To 31 E-value: 0.00001 Score: 40.4
SIPCAESCVYIPCITGIAGCSCKNKVCYYN
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
- 1 Target: Bacillus subtilis ATCC 6633 -: NA - ( )
- 2 Target: Listeria monocytogenes ATCC 19115 -: NA - ( )
- 3 Target: Micrococcus luteus ATCC 9341 -: NA - ( )
- 4 Target: Staphylococcus epidermidis ATCC 12228 -: NA - ( )
- 5 Target: Bacillus cereus ATCC 10876 -: NA - ( )
- 6 Target: Staphylococcus aureus ATCC 25923 -: NA - ( )
- 7 Target: Salmonella typhimurium ATCC 14028 -: NA - ( )
- 8 Target: Vibrio parahaemolyticus ISP 72-01 -: NA - ( )
- 9 Target: Escherichia coli ATCC 25922 -: NA - ( )
- 10 Target: Salmonella enteritidis ISP 1833-99 -: NA - ( )
- 11 Target: Aeromonas hydrophila ATCC 7966 -: NA - ( )
- 12 Target: Pseudomonas aeruginosa ATCC 27853 -: NA - ( )
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
No references found on LAMP database
Comments
- Comments
No comments found on LAMP database