Record in detail


General Info

  • lamp_id:L12A010281
  • Name:
  • FullName:
  • Source:
  • Mass:6774.8 Da
  • Sequence Length:59 aa
  • Isoelectric Point:9.86
  • Activity:Antimicrobial
  • Sequence
        QTSPEGWFRTCFYGMGKCRHVCRANEKKKERCGENSFCCLGETKSKLSNIPTNKGRKKD
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF351    From 28 To 86 E-value: 2e-31 Score: 125
        QTSPEGWFRTCFYGMGKCRHVCRANEKKKERCGENSFCCLGETKSKLSNIPTNKGRKKD
  • 2. L12A10281|    From 1 To 59 E-value: 2e-30 Score: 122
        QTSPEGWFRTCFYGMGKCRHVCRANEKKKERCGENSFCCLGETKSKLSNIPTNKGRKKD
  • 3. L12A11194|    From 1 To 57 E-value: 1e-22 Score: 96.7
        SPEGWFRTCFYGLGKCRRICRANEKKKERCGERTFCCLRETNSRLSHIPVTKDREKD
  • 4. L05A0DEF16    From 28 To 81 E-value: 0.0000000000002 Score: 66.2
        QTAPDGWIRRCYYGTGRCRKSCKEIERKKEKCGEKHICCVPKEKDKLSHIHDQK
  • 5. L01A003704    From 1 To 54 E-value: 0.0000000000002 Score: 65.9
        QTAPDGWIRRCYYGTGRCRKSCKEIERKKEKCGEKHICCVPKEKDKLSHIHDQK

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli KCTC 1682  MIC:  8±0 μM  ( )  
  •   2  Target:  Salmonella typhimurium KCTC 1926  MIC:  8±0 μM  ( )  
  •   3  Target:  Staphylococcus epidermidis KCTC 1917  MIC:  13.3±1.3 μM  ( )  
  •   4  Target:  Staphylococcus aureus KCTC 1621  MIC:  24±4 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: