Record in detail


General Info

  • lamp_id:L12A010288
  • Name:
  • FullName:
  • Source:
  • Mass:8387.4 Da
  • Sequence Length:79 aa
  • Isoelectric Point:6.89
  • Activity:Antibacterial,AntiGram_n
  • Sequence
        QVLLAAGAGVALSELLGPVLVGAGTLAGAALLNQAVSSNRWVIPCANNRGWCRTDCHFGEHIDDYHSDICHSGYKCCRY
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A10288|    From 1 To 79 E-value: 1.00053e-42 Score: 163
        QVLLAAGAGVALSELLGPVLVGAGTLAGAALLNQAVSSNRWVIPCANNRGWCRTDCHFGEHIDDYHSDICHSGYKCCRY
  • 2. L12A00731|    From 47 To 79 E-value: 0.00000002 Score: 49.7
        CANNRGWCRSRCFSHEYIDSWHSDVCGS-YDCCR
  • 3. L01A003053    From 24 To 77 E-value: 0.0000002 Score: 46.2
        LVGAAAVT-AANIRRASSDNH---SCAGNRGWCRSKCFRHEYVDTYYSAVC-GRYFCCR
  • 4. L12A09937|    From 57 To 89 E-value: 0.0000003 Score: 45.8
        CANNRGWCRSSCFSHEYIDYYNSAVC-GRYRCCR
  • 5. L12A09939|    From 57 To 89 E-value: 0.0000003 Score: 45.4
        CANNRGWCRSSCFSHEYIDYYNSAVC-GRYRCCR

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli ATCC 9637  MIC:  4.8 μM  ( )  
  •   2  Target:  Escherichia coli ATCC 25922  MIC:  4.8 μM  ( )  
  •   3  Target:  Escherichia coli ATCC 25922  MIC:  11.5 μM  ( )  
  •   4  Target:  Escherichia coli ATCC 25922  MIC:  5.6 μM  ( )  
  •   5  Target:  Escherichia coli ATCC 25922  MIC:  22 μM  ( )  
  •   6  Target:  Escherichia coli ATCC 25922  MIC:  5.6 μM  ( )  
  •   7  Target:  Escherichia coli ATCC 25922  MIC:  5.6 μM  ( )  
  •   8  Target:  Pseudomonas aeruginosa ATCC BAA-427  MIC:  32 μM  ( )  
  •   9  Target:  Klebsiella pneumoniae ATCC 27736  MIC:  5.1 μM  ( )  
  •   10  Target:  Bacillus subtilis ATCC 6633  MIC:  2.1 μM  ( )  
  •   11  Target:  Staphylococcus aureus ATCC 25923  MIC:  2 μM  ( )  
  •   12  Target:  Staphylococcus aureus ATCC 700698  MIC:  4.4 μM  ( )  
  •   13  Target:  Staphylococcus aureus ATCC 700699  MIC:  4.5 μM  ( )  
  •   14  Target:  Staphylococcus aureus ATCC BAA-44  MIC:  4.4 μM  ( )  
  •   15  Target:  Staphylococcus aureus ATCC 29213  MIC:  4.4 μM  ( )  
  •   16  Target:  Staphylococcus aureus ATCC 33592  MIC:  18 μM  ( )  
  •   17  Target:  Candida albicans ATCC 10231  MIC:  9 μM  ( )  
  •   18  Target:  Cryptococcus neoformans  MIC:  18 μM  ( )  
  •   19  Target:  Candida parapsilosis ATCC 22019  MIC:  9 μM  ( )  
  •   20  Target:  Sporothrix schenckii  MIC:  18 μM  ( )  
  •   21  Target:  Trichophyton mentagrophytes  MIC:  >35 μM  ( )  
  •   22  Target:  Aspergillus fumigatus  MIC:  >35 μM  ( )  
  •   23  Target:  Human breast adenocarcinoma MDA-MB-231  IC50:  15.4 μM  ( )  
  •   24  Target:  Human cervical carcinoma HeLa  IC50:  13.8 μM  ( )  
  •   25  Target:  Human colon adenocarcinoma DLD-1  IC50:  15.3 μM  ( )  
  •   26  Target:  Human hepatocellular carcinoma HepG2  IC50:  5 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: