Record in detail


General Info

  • lamp_id:L12A010349
  • Name:
  • FullName:
  • Source:
  • Mass:4415.4 Da
  • Sequence Length:41 aa
  • Isoelectric Point:8.56
  • Activity:Antimicrobial
  • Sequence
        RCIALFLVLSLVALMAEPGEGFIFHIIKGLVHAGKMIHGLV
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A10349|    From 1 To 41 E-value: 1e-17 Score: 79.7
        RCIALFLVLSLVALMAEPGEGFIFHIIKGLVHAGKMIHGLV
  • 2. L12A10348|    From 1 To 41 E-value: 0.000000000000002 Score: 73.2
        RCIALFFVLSLVVLMAEPGEGFFFHIIKGLFHAGKMIHGLI
  • 3. L12A09005|    From 2 To 42 E-value: 0.000000000005 Score: 61.2
        RCIALFLVLSLVVLMAEPGEGFIFHIIKGLFHAGKMIHGLV
  • 4. L12A09004|    From 2 To 42 E-value: 0.00000000003 Score: 58.9
        RCIALFLVLSLVVLMAEPGEGFFFHIIKGLFHAGRMIHGLV
  • 5. L12A10350|    From 1 To 41 E-value: 0.00000000009 Score: 57.4
        RCIALFLVLSLVVLMAEPGEGFFFHIIKGLFHAGRMIHGLV

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli NBRC 14237  MIC:  3.12 μM  ( )  
  •   2  Target:  Staphylococcus aureus NBRC 12732  MIC:  1.57 μM  ( )  
  •   3  Target:  Micrococcus luteus NBRC 12708  MIC:  3.12 μM  ( )  
  •   4  Target:  Saccharomyces cerevisiae NBRC 10217  MIC:  6.25 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: