Record in detail


General Info

  • lamp_id:L12A010438
  • Name:
  • FullName:
  • Source:
  • Mass:4481.2 Da
  • Sequence Length:39 aa
  • Isoelectric Point:8.12
  • Activity:Antimicrobial
  • Sequence
        RGKFKEICERPNGSCRDFCLETEIHVGRCLNSRPCCLPL
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08188|    From 32 To 69 E-value: 3e-18 Score: 82
        GKFKEICERPNGSCRDFCLETEIHVGRCLNSRPCCLPL
  • 2. L12A10438|    From 1 To 39 E-value: 7e-18 Score: 80.9
        RGKFKEICERPNGSCRDFCLETEIHVGRCLNSRPCCLPL
  • 3. L12A00509|    From 2 To 40 E-value: 9e-18 Score: 80.5
        RGKFKEICERPDGSCRDFCLETEIHVGRCLNSRPCCLPL
  • 4. L01A003576    From 1 To 37 E-value: 6e-17 Score: 77.8
        KFKEICERPNGSCRDFCLETEIHVGRCLNSRPCCLPL
  • 5. L01A003487    From 1 To 37 E-value: 1e-16 Score: 76.6
        KFKEICERPNGSCRDFCLETEIHVGRCLNSQPCCLPL

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Aeromonas hydrophila ATCC 23213  100% Inhib:  100 μM  ( )  
  •   2  Target:  Escherichia coli  100% Inhib:  25 μM  ( )  
  •   3  Target:  Vibrio anguillarum ATCC 19106  -:  NA -  ( )  
  •   4  Target:  Vibrio alginolyticus ATCC 19108  100% Inhib:  50 μM  ( )  
  •   5  Target:  Vibrio ordalii  100% Inhib:  25 μM  ( )  
  •   6  Target:  Micrococcus luteus ATCC 4698  -:  NA -  ( )  
  •   7  Target:  Staphylococcus epidermidis ATCC 49461  100% Inhib:  100 μM  ( )  
  •   8  Target:  Piscirickettsia salmonis LF-89  100% Inhib:  100 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: