Record in detail


General Info

  • lamp_id:L12A010475
  • Name:
  • FullName:
  • Source:
  • Mass:4695.5 Da
  • Sequence Length:40 aa
  • Isoelectric Point:8.63
  • Activity:Antimicrobial
  • Sequence
        RIETCRNFRGSCRDECLKNERVYVFCVSGKLCCLKPKDQP
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A10475|    From 1 To 40 E-value: 2e-18 Score: 83.2
        RIETCRNFRGSCRDECLKNERVYVFCVSGKLCCLKPKDQP
  • 2. L05A0DEF22    From 23 To 61 E-value: 9e-17 Score: 77.4
        IEKCWNFRGSCRDECLKNEKVYVFCMSGKLCCLKPKDQP
  • 3. L01A003722    From 4 To 42 E-value: 3e-16 Score: 75.9
        IEKCWNFRGSCRDECLKNEKVYVFCMSGKLCCLKPKDQP
  • 4. L12A10474|    From 1 To 40 E-value: 3e-16 Score: 75.5
        RIEKCWNFRGSCCDECLKNERVYVFCVSGKLCCLKPKDQP
  • 5. L12A11261|    From 2 To 40 E-value: 6e-16 Score: 74.7
        TEKCWNFRGSCRDECLKNERFYVFCVSGKLCCLKPKDQP

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Aeromonas hydrophila ATCC 23213  -:  NA -  ( )  
  •   2  Target:  Escherichia coli  100% inhib:  50 μM  ( )  
  •   3  Target:  Vibrio anguillarum ATCC 19106  -:  NA -  ( )  
  •   4  Target:  Vibrio alginolyticus ATCC 19108  100% inhib:  50 μM  ( )  
  •   5  Target:  Vibrio ordalii  100% inhib:  25 μM  ( )  
  •   6  Target:  Micrococcus luteus ATCC 4698  -:  NA -  ( )  
  •   7  Target:  Staphylococcus epidermidis ATCC 49461  100% inhib:  50 μM  ( )  
  •   8  Target:  Piscirickettsia salmonis LF-89  -:  NA -  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: