Record in detail


General Info

  • lamp_id:L12A010770
  • Name:
  • FullName:
  • Source:
  • Mass:6365.5 Da
  • Sequence Length:55 aa
  • Isoelectric Point:9.12
  • Activity:Antimicrobial
  • Sequence
        RSGPNVYIQKIFASCWRLQGTCRPKCLKNEQYHILCDTIHLCCVNPKYLPILTGK
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A06539|    From 23 To 77 E-value: 4e-29 Score: 118
        RSGPNVYIQKIFASCWRLQGTCRPKCLKNEQYHILCDTIHLCCVNPKYLPILTGK
  • 2. L12A10770|    From 1 To 55 E-value: 1e-28 Score: 116
        RSGPNVYIQKIFASCWRLQGTCRPKCLKNEQYHILCDTIHLCCVNPKYLPILTGK
  • 3. L12A06541|    From 23 To 77 E-value: 2e-28 Score: 115
        RSGPNVYIQKIFASCWRLQGTCRPKCLKNEQYRILCDTIHLCCVNPKYLPILTGK
  • 4. L12A03935|    From 1 To 53 E-value: 2e-27 Score: 112
        GPNVYIQKIFASCWRLQGTCRPKCLKNEQYHILCDTIHLCCVNPKYLPILTGK
  • 5. L01A003692    From 1 To 53 E-value: 1e-26 Score: 109
        GPNVYIQKIFASCWRLQGTCRPKCLKNEQYRILCDTIHLCCVNPKYLPILTGK

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Staphylococcus aureus ATCC 29213  MIC:  32 μg/ml  ( )  
  •   2  Target:  Bacillus subtilis ATCC 6051  MIC:  8 μg/ml  ( )  
  •   3  Target:  Escherichia coli ATCC 25922  MIC:  128 μg/ml  ( )  
  •   4  Target:  Pseudomonas aeruginosa ATCC 27853  MIC:  128 μg/ml  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: