Record in detail


General Info

  • lamp_id:L12A010774
  • Name:
  • FullName:
  • Source:
  • Mass:5681.4 Da
  • Sequence Length:45 aa
  • Isoelectric Point:8.1
  • Activity:Antimicrobial
  • Sequence
        RSNFDEKPKYRIERCERVRGFCKTFCDDDEYDYGYCVRWRKQCCI
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A10774|    From 1 To 45 E-value: 3e-21 Score: 92.4
        RSNFDEKPKYRIERCERVRGFCKTFCDDDEYDYGYCVRWRKQCCI
  • 2. L05A0DEF11    From 20 To 62 E-value: 6e-16 Score: 74.3
        RSNFE--PKYRFERCEKVRGICKTFCDDVEYDYGYCIKWRSQCCV
  • 3. L12A10957|    From 5 To 44 E-value: 0.000000000000005 Score: 71.6
        QQPKYRFERCERVRGICKTFCDDVEYDYGYCIKWRSQCCV
  • 4. L01A003686    From 1 To 41 E-value: 0.000000000000007 Score: 70.9
        NFD--PKYRFERCAKVKGICKTFCDDDEYDYGYCIKWRNQCCI
  • 5. L01A003709    From 3 To 41 E-value: 0.00000000000002 Score: 69.3
        EPKYRFERCEKVRGICKTFCDDVEYDYGYCIKWRSQCCV

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Staphylococcus aureus ATCC 29213  MIC:  2 μg/ml  ( )  
  •   2  Target:  Bacillus subtilis ATCC 6051  MIC:  0.25 μg/ml  ( )  
  •   3  Target:  Escherichia coli ATCC 25922  MIC:  32 μg/ml  ( )  
  •   4  Target:  Pseudomonas aeruginosa ATCC 27853  MIC:  256 μg/ml  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: