Record in detail


General Info

  • lamp_id:L12A010828
  • Name:
  • FullName:
  • Source:
  • Mass:4198.6 Da
  • Sequence Length:38 aa
  • Isoelectric Point:7.03
  • Activity:Antimicrobial
  • Sequence
        RVGPCDQVCSRIDAEKDECCRAHGYSGYNSCRGGRMDC
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A10828|    From 1 To 38 E-value: 3e-17 Score: 79
        RVGPCDQVCSRIDAEKDECCRAHGYSGYNSCRGGRMDC
  • 2. L01A000314    From 2 To 39 E-value: 0.000000000001 Score: 63.9
        HVGPCDQVCSRIDPEKDECCRAHGYRGHSSCYYGRMEC
  • 3. L12A07373|    From 27 To 64 E-value: 0.0000000002 Score: 56.6
        RIGPCDQVCPRIVPERHECCRAHGRSGYAYCSGGGMYC
  • 4. L01A003270    From 3 To 40 E-value: 0.0000000007 Score: 54.3
        RIGPCDQVCPRIVPERHECCRAHGRSGYAYCSGGGMYC
  • 5. L01A002349    From 6 To 39 E-value: 0.000000003 Score: 52.4
        RVPPCDQVCSRTNPEKDECCRAHGHAFHATCSGG

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Staphylococcus aureus ATCC 29213  MIC:  >100 μg/ml  ( )  
  •   2  Target:  Serratia marcescens ATCC 21202  MIC:  >100 μg/ml  ( )  
  •   3  Target:  Escherichia coli ATCC 25922  MIC:  >100 μg/ml  ( )  
  •   4  Target:  Klebsiella pneumoniae ATCC 700603  MIC:  >100 μg/ml  ( )  
  •   5  Target:  Salmonella enteritidis ATCC 13076  MIC:  >100 μg/ml  ( )  
  •   6  Target:  Bacillus cereus ATCC 11778  MIC:  >100 μg/ml  ( )  
  •   7  Target:  Streptococcus pyogenes ATCC 19615  MIC:  >100 μg/ml  ( )  
  •   8  Target:  Pseudomonas aeruginosa ATCC 27853  MIC:  >100 μg/ml  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: