Record in detail
General Info
- lamp_id:L12A010833
- Name:
- FullName:
- Source:
- Mass:5007.9 Da
- Sequence Length:42 aa
- Isoelectric Point:8.62
- Activity:Antimicrobial
- Sequence
RVKCAMKDTYSCFIMRGKCRHECHDFEKPIGFCTKLNVNCYM - Function:
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ7960
- 2 Database:dbAMP dbAMP_10833
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L12A10833| From 1 To 42 E-value: 1e-20 Score: 90.1
RVKCAMKDTYSCFIMRGKCRHECHDFEKPIGFCTKLNVNCYM - 2. L12A11798| From 1 To 41 E-value: 2e-19 Score: 85.9
VKCAMKDTYSCFIMKGKCRHECHDFEKPIGFCTKLNANCYM - 3. L12A10782| From 3 To 43 E-value: 6e-19 Score: 84.3
VKCAVKDTYSCFIVRGKCRHECHDFEKPIGFCTKLNANCYM - 4. L01A003694 From 1 To 41 E-value: 8e-19 Score: 84
VKCAVKDTYSCFIVRGKCRHECHDFEKPIGFCTKLNANCYM - 5. L12A11801| From 1 To 41 E-value: 1e-18 Score: 83.2
VKCPMKDNYSCFIMRGKCRHECHDFEKPIGFCTKLNANCYM
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
- 1 Target: Staphylococcus aureus NCTC 10788 MIC: 2 μM ( )
- 2 Target: Staphylococcus aureus NCTC 10788 MBC: 4 μM ( )
- 3 Target: Staphylococcus aureus NCTC 12493 MIC: 2 μM ( )
- 4 Target: Staphylococcus aureus NCTC 12493 MBC: 4 μM ( )
- 5 Target: Candida albicans NCYC 1467 MIC: 2 μM ( )
- 6 Target: Candida albicans NCYC 1467 MBC: 2 μM ( )
- 7 Target: Escherichia coli NCTC 10418 MIC: 8 μM ( )
- 8 Target: Escherichia coli NCTC 10418 MBC: 8 μM ( )
- 9 Target: Pseudomonas aeruginosa ATCC 27853 MIC: 32 μM ( )
- 10 Target: Pseudomonas aeruginosa ATCC 27853 MBC: 64 μM ( )
- 11 Target: Human squamous lung carcinoma NCI-H157 IC50: 2.85 μM ( )
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
No references found on LAMP database
Comments
- Comments
No comments found on LAMP database