Record in detail


General Info

  • lamp_id:L12A011195
  • Name:
  • FullName:
  • Source:
  • Mass:5390.4 Da
  • Sequence Length:47 aa
  • Isoelectric Point:9.17
  • Activity:Antimicrobial
  • Sequence
        SPEKCWNLHGSCRDKCSKNEKVYVFCVSGKLCCVKPKFQPNLFPKVN
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A11195|    From 1 To 47 E-value: 1e-22 Score: 96.7
        SPEKCWNLHGSCRDKCSKNEKVYVFCVSGKLCCVKPKFQPNLFPKVN
  • 2. L12A11912|    From 4 To 49 E-value: 3e-18 Score: 82.4
        STEKCWNLHGKCRDTCSRNEKIYVFCLSGKLCCVKPKFQPNTSPQL
  • 3. L12A08353|    From 21 To 66 E-value: 4e-18 Score: 82
        STEKCWNLHGHCRDTCSRNEKVFVFCLSGKLCCVKPKFQPNTSPRL
  • 4. L12A08242|    From 21 To 66 E-value: 1e-17 Score: 80.1
        STEKCWKLHGKCRDTCSRNEKIYVFCLSGKLCCVKPKFQPNTSPQL
  • 5. L12A08177|    From 21 To 65 E-value: 2e-17 Score: 79.3
        STEKCWNLHGSCRDKCVKKEKVYVFCTSGKLCCVKLKFQPDLSPK

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Enterococcus faecium Com15  MIC:  128 μg/ml  ( )  
  •   2  Target:  Staphylococcus aureus USA 300  MIC:  >128 μg/ml  ( )  
  •   3  Target:  Klebsiella pneumoniae ATCC 10031  MIC:  >128 μg/ml  ( )  
  •   4  Target:  Acinetobacter baumannii ATCC 17978  MIC:  64 μg/ml  ( )  
  •   5  Target:  Pseudomonas aeruginosa PAO1  MIC:  128 μg/ml  ( )  
  •   6  Target:  Enterobacter cloacae ATCC 13047  MIC:  >128 μg/ml  ( )  
  •   7  Target:  Candida albicans ATCC 18804  MIC:  8 μg/ml  ( )  
  •   8  Target:  Candida albicans ATCC 76485  MIC:  4 μg/ml  ( )  
  •   9  Target:  Schizosaccharomyces pombe SAK1  MIC:  4 μg/ml  ( )  
  •   10  Target:  Saccharomyces cerevisiae W303  MIC:  4 μg/ml  ( )  
  •   11  Target:  Cryptococcus albidus ATCC 10666  MIC:  4 μg/ml  ( )  
  •   12  Target:  Cryptococcus neoformans ATCC 32045  MIC:  2 μg/ml  ( )  
  •   13  Target:  Stachybotrys chartarum ATCC 201867  MIC:  4 μg/ml  ( )  
  •   14  Target:  Bacillus subtilis 169 1A1  MIC:  64 μg/ml  ( )  
  •   15  Target:  Lactobacillus rhamnosus LSM2-1  MIC:  16 μg/ml  ( )  
  •   16  Target:  Streptococcus mitis B6  MIC:  128 μg/ml  ( )  
  •   17  Target:  Streptococcus sobrinus W1703  MIC:  32 μg/ml  ( )  
  •   18  Target:  Staphylococcus epidermidis RP62A  MIC:  64 μg/ml  ( )  
  •   19  Target:  Escherichia coli BAS 849  MIC:  64 μg/ml  ( )  
  •   20  Target:  Escherichia coli DH5alpha  MIC:  128 μg/ml  ( )  
  •   21  Target:  Citrobacter koseri BAA-895  MIC:  128 μg/ml  ( )  
  •   22  Target:  Salmonella enterica subsp. enterica  MIC:  128 μg/ml  ( )  
  •   23  Target:  Human colon adenocarcinoma HT29  LC:  >128 μg/ml  ( )  
  •   24  Target:  Human cervical carcinoma HeLa  LC:  >128 μg/ml  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: