Record in detail


General Info

  • lamp_id:L12A011296
  • Name:
  • FullName:
  • Source:
  • Mass:9782.2 Da
  • Sequence Length:85 aa
  • Isoelectric Point:8.12
  • Activity:Antibacterial,AntiGram_p
  • Sequence
        SVPKVVYDGPIYELRQIEEENIEPDTELMDSNEPLLPLRHRRVTCDVLSWQSKWLSINHSACAIRCLAQRRKGGSCRNGVCICRK
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A11296|    From 1 To 85 E-value: 0 Score: 176
        SVPKVVYDGPIYELRQIEEENIEPDTELMDSNEPLLPLRHRRVTCDVLSWQSKWLSINHSACAIRCLAQRRKGGSCRNGVCICRK
  • 2. L05ADEF393    From 1 To 43 E-value: 7e-21 Score: 90.9
        VTCDVLSWQSKWLSINHSACAIRCLAQRRKGGSCRNGVCICRK
  • 3. L12A08079|    From 24 To 97 E-value: 1e-20 Score: 90.1
        VYDGPTYELTTIDE----PQYDEMASN--LSPIRHRRVTCDLLSWQSQWLTINHSACAAKCLVQRRRGGRCRDGICVCRN
  • 4. L05ADEF552    From 1 To 42 E-value: 0.000000000000002 Score: 73.2
        FSCDVLSFQSKWVSPNHSACAVRCLAQRRKGGKCKNGDCVCR
  • 5. L05ADEF539    From 1 To 42 E-value: 0.00000000000002 Score: 69.7
        VTCDVLSFEAKGIAVNHSACALHCIALRKKGGSCQNGVCVCR

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli MG1655  -:  NA -  ( )  
  •   2  Target:  Pseudomonas aeruginosa NCTC 6750  -:  NA -  ( )  
  •   3  Target:  Staphylococcus aureus NCTC 8530  -:  NA -  ( )  
  •   4  Target:  Candida albicans ATCC 18804  MFC:  60 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: