Record in detail


General Info

  • lamp_id:L12A011394
  • Name:
  • FullName:
  • Source:
  • Mass:3425.9 Da
  • Sequence Length:32 aa
  • Isoelectric Point:8.64
  • Activity:Antimicrobial
  • Sequence
        TCVSKSNCAAVCQTEGFPGGNCRGLRRRCFCT
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A11394|    From 1 To 32 E-value: 0.0000000000003 Score: 65.9
        TCVSKSNCAAVCQTEGFPGGNCRGLRRRCFCT
  • 2. L02A001330    From 13 To 44 E-value: 0.00000000003 Score: 58.9
        TCVRQSNCAAVCQTEGFHGGNCRGFRRRCFCT
  • 3. L12A07789|    From 44 To 74 E-value: 0.00000000009 Score: 57.4
        CVRNSNCAAICQTEGFQGGHCRGLRRRCFCT
  • 4. L12A06235|    From 44 To 74 E-value: 0.0000000003 Score: 55.8
        CFSKSNCASVCHTEGFYGGHCRGFRRRCFCT
  • 5. L03A000162    From 43 To 74 E-value: 0.0000000003 Score: 55.5
        TCVSASNCANVCHNEGFVGGNCRGFRRRCFCT

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli ATCC 25922  MIC:  50 μg/ml  ( )  
  •   2  Target:  Pseudomonas aeruginosa ATCC 27853  MIC:  200 μg/ml  ( )  
  •   3  Target:  Staphylococcus aureus ATCC 25923  MIC:  50 μg/ml  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: