Record in detail


General Info

  • lamp_id:L12A011572
  • Name:
  • FullName:
  • Source:
  • Mass:5256.9 Da
  • Sequence Length:44 aa
  • Isoelectric Point:4.5
  • Activity:Antimicrobial
  • Sequence
        TTKKSLLLLFFLATINLSLCEEERNAEEKRRDDPDEMNVEMEKR
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A11572|    From 1 To 44 E-value: 8e-20 Score: 87.4
        TTKKSLLLLFFLATINLSLCEEERNAEEKRRDDPDEMNVEMEKR
  • 2. L01A003834    From 3 To 47 E-value: 0.000000000000004 Score: 71.6
        TFKKSMLLLFFLGTINLSLCEQERNADEEERRDDPDETNVEVEKR
  • 3. L12A11512|    From 1 To 44 E-value: 0.00000000000003 Score: 68.9
        TMKKSLLLIFFLGTINLSLCQEERNAEEEKRDGDDEMDAEVEKR
  • 4. L12A07168|    From 3 To 47 E-value: 0.00000000000004 Score: 68.6
        TLKKSMLLLFFLGTINLSLCEQERNADEEERRDNPDEMDVVVEKR
  • 5. L12A07345|    From 3 To 46 E-value: 0.00000000000009 Score: 67.4
        TMKKSMLLLFFLGTINLSLCEQERDAEEERRDDEDKRDVEVEKR

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli ATCC 25922  MIC:  37.5 μg/ml  ( )  
  •   2  Target:  Helicobacter pylori 11637  MIC:  9.38 μg/ml  ( )  
  •   3  Target:  Helicobacter pylori 26695  MIC:  9.38 μg/ml  ( )  
  •   4  Target:  Pseudomonas aeruginosa ATCC 27853  MIC:  37.5 μg/ml  ( )  
  •   5  Target:  Staphylococcus aureus ATCC 25923  MIC:  75 μg/ml  ( )  
  •   6  Target:  Bacillus subtilis  MIC:  >200 μg/ml  ( )  
  •   7  Target:  Enterococcus faecalis  MIC:  >200 μg/ml  ( )  
  •   8  Target:  Staphylococcus epidermidis  MIC:  >200 μg/ml  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: