Record in detail


General Info

  • lamp_id:L12A011674
  • Name:
  • FullName:
  • Source:
  • Mass:9803.3 Da
  • Sequence Length:94 aa
  • Isoelectric Point:7.01
  • Activity:Antimicrobial
  • Sequence
        VCYKNSLALPTLEKDVITPEALEAVLKSNGGATVNIKTIVSNTIFEEALLNNANHGLGGTIPCGESCVFIPCLTSAIGCSCKSKVCYKNSLALN
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A11674|    From 1 To 94 E-value: 0 Score: 186
        VCYKNSLALPTLEKDVITPEALEAVLKSNGGATVNIKTIVSNTIFEEALLNNANHGLGGTIPCGESCVFIPCLTSAIGCSCKSKVCYKNSLALN
  • 2. L12A12205|    From 1 To 92 E-value: 0 Score: 179
        YKNSLALPTLEKDVITPEALEAVLKSNGGAIVNIKTIVSNTIFEEALLNNANHGLGGTIPCGESCVFIPCLTSAIGCSCKSKVCYKNSLALN
  • 3. L12A12205|    From 83 To 91 E-value: 4.7 Score: 21.6
        VCYKNSLAL
  • 4. L12A05611|    From 1 To 98 E-value: 3e-22 Score: 95.5
        LATFERDVITPETVHAILKKTNSNSNIMLHEDAIQALTGKTLISKTVLEEALLKNAENGLVGSGVPCGESCVWIPCLTSIVGCSCKNNVCTLNSLAQN
  • 5. L12A05610|    From 1 To 93 E-value: 6e-21 Score: 90.9
        LATFEKDVITAETIQAVIKRTAPLSNIMLEGDAINALLTSKTVISKTVLEEAFLKT--DATNGVIPCGESCVFIPCISSVLGCSCKNKVCYRNSL

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Staphylococcus aureus ATCC 29213  MIC:  4 μM  ( )  
  •   2  Target:  Staphylococcus aureus ATCC 29213  MBC:  8 μM  ( )  
  •   3  Target:  Listeria monocytogenes ATCC 7611  MIC:  4 μM  ( )  
  •   4  Target:  Listeria monocytogenes ATCC 7611  MBC:  8 μM  ( )  
  •   5  Target:  Lactobacillus casei HZ1  MIC:  32 μM  ( )  
  •   6  Target:  Lactobacillus casei HZ1  MBC:  64 μM  ( )  
  •   7  Target:  Klebsiella pneumoniae ATCC 700603  MIC:  >256 μM  ( )  
  •   8  Target:  Klebsiella pneumoniae ATCC 700603  MBC:  >256 μM  ( )  
  •   9  Target:  Enterobacter aerogenes ATCC 13048  MIC:  64 μM  ( )  
  •   10  Target:  Enterobacter aerogenes ATCC 13048  MBC:  128 μM  ( )  
  •   11  Target:  Saccharomyces cerevisiae  MIC:  >256 μM  ( )  
  •   12  Target:  Saccharomyces cerevisiae  MBC:  >256 μM  ( )  
  •   13  Target:  Pichia pastoris  MIC:  >256 μM  ( )  
  •   14  Target:  Pichia pastoris  MBC:  >256 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: