Record in detail


General Info

  • lamp_id:L12A011819
  • Name:
  • FullName:
  • Source:
  • Mass:7586.5 Da
  • Sequence Length:65 aa
  • Isoelectric Point:8.38
  • Activity:Antimicrobial
  • Sequence
        VKRGKSLRCMATIGTCRHSCKKNEHPYYHCRDYQTCCLPSFMRISITGTDENNEWSDGNYWPQAP
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A11819|    From 1 To 65 E-value: 5e-36 Score: 141
        VKRGKSLRCMATIGTCRHSCKKNEHPYYHCRDYQTCCLPSFMRISITGTDENNEWSDGNYWPQAP
  • 2. L12A08039|    From 17 To 81 E-value: 1e-34 Score: 136
        VMPGKSLRCMATIGTCRHSCKKNEHPYYHCRDYQTCCLPSFMRISITGTDENNEWSDGNYWPQAP
  • 3. L12A03206|    From 6 To 64 E-value: 4e-21 Score: 91.7
        LRCMGNTGVCRPSCKKNEQPYYYCRNYQPCCLQSYMRISITGAEGNNDWSYGNHWPKIP
  • 4. L12A08219|    From 26 To 84 E-value: 9e-19 Score: 84
        LRCMGNSGICRASCKKNEQPYLYCRNYQACCLQSYMRISISGKEENTDWSYEKQWPRLP
  • 5. L12A03232|    From 6 To 64 E-value: 1e-18 Score: 83.6
        LRCMGNSGICRASCKKNEQPYLYCRNYQACCLQSYMRISISGKEENTDWSYEKQWPRLP

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli ATCC 25922  MBC50:  <6.25 μM  ( )  
  •   2  Target:  Escherichia coli ATCC 25922  MBC90:  <6.25 μM  ( )  
  •   3  Target:  Staphylococcus aureus ATCC 25923  MBC50:  <6.25 μM  ( )  
  •   4  Target:  Staphylococcus aureus ATCC 25923  MBC90:  <6.25 μM  ( )  
  •   5  Target:  Staphylococcus aureus BCRC 80277  MBC50:  0.5 μM  ( )  
  •   6  Target:  Staphylococcus aureus BCRC 80277  MBC90:  1 μM  ( )  
  •   7  Target:  Acinetobacter baumannii  MBC50:  0.5 μM  ( )  
  •   8  Target:  Acinetobacter baumannii  MBC90:  1 μM  ( )  
  •   9  Target:  Human hepatocellular carcinoma HepG2  20% Killin:  50 μM  ( )  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: