Record in detail


General Info

  • lamp_id:L12A011867
  • Name:
  • FullName:
  • Source:
  • Mass:8980.1 Da
  • Sequence Length:82 aa
  • Isoelectric Point:10.23
  • Activity:Antimicrobial
  • Sequence
        VPNFNTIGGGVDYMYKNKVGASLGMASTPFLDRKDYSAMGNLNLFRSPTTSVDFSGGFKKFESPFMSSGWKPNFGLTFGRSF
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A11867|    From 1 To 82 E-value: 3.9937e-43 Score: 164
        VPNFNTIGGGVDYMYKNKVGASLGMASTPFLDRKDYSAMGNLNLFRSPTTSVDFSGGFKKFESPFMSSGWKPNFGLTFGRSF
  • 2. L12A00186|    From 13 To 95 E-value: 3e-24 Score: 102
        VPNFNTVGGGLDYMYKNKVGGSLGVAHTPFLQRTDYSANGMVNLFRNKDTSLDFNAGLSKSVSPFMPNSRWEPSTGFTLRKFF
  • 3. L12A11532|    From 6 To 24 E-value: 0.034 Score: 28.9
        EVPSFSSRWEPNFGLTFSK
  • 4. L12A08515|    From 28 To 61 E-value: 0.16 Score: 26.6
        SPSVQTQIDAEFRRVVSPYMSSSGWLCTLTIECG
  • 5. L01A002890    From 28 To 59 E-value: 7 Score: 21.2
        NNVHGGYEFMYQGQTAAAYNTDNCKGVAQTRF

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Staphylococcus aureus NCTC 10788  MIC:  2 μM  ( )  
  •   2  Target:  Staphylococcus aureus NCTC 10788  MBC:  2 μM  ( )  
  •   3  Target:  Enterococcus faecalis NCTC 12697  MIC:  8 μM  ( )  
  •   4  Target:  Enterococcus faecalis NCTC 12697  MBC:  16 μM  ( )  
  •   5  Target:  Staphylococcus aureus NCTC 12493  MIC:  4 μM  ( )  
  •   6  Target:  Staphylococcus aureus NCTC 12493  MBC:  4 μM  ( )  
  •   7  Target:  Escherichia coli NCTC 10418  MIC:  4 μM  ( )  
  •   8  Target:  Escherichia coli NCTC 10418  MBC:  8 μM  ( )  
  •   9  Target:  Pseudomonas aeruginosa ATCC 27853  MIC:  32 μM  ( )  
  •   10  Target:  Pseudomonas aeruginosa ATCC 27853  MBC:  64 μM  ( )  
  •   11  Target:  Klebsiella pneumoniae ATCC 43816  MIC:  8 μM  ( )  
  •   12  Target:  Klebsiella pneumoniae ATCC 43816  MBC:  16 μM  ( )  
  •   13  Target:  Candida albicans NCYC 1467  MIC:  2 μM  ( )  
  •   14  Target:  Candida albicans NCYC 1467  MBC:  4 μM  ( )  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: