Record in detail


General Info

  • lamp_id:L12A011893
  • Name:
  • FullName:
  • Source:
  • Mass:8651.1 Da
  • Sequence Length:76 aa
  • Isoelectric Point:8.37
  • Activity:Antimicrobial
  • Sequence
        VRPKKCFNNIAGYCRKKCEMGEISEISCLNGKLCCVNEGRNKKQEEAKDVLQFPLLSDQKLDYVILPTITVFTIQP
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A11893|    From 1 To 76 E-value: 9.99995e-41 Score: 156
        VRPKKCFNNIAGYCRKKCEMGEISEISCLNGKLCCVNEGRNKKQEEAKDVLQFPLLSDQKLDYVILPTITVFTIQP
  • 2. L12A04867|    From 1 To 75 E-value: 9e-24 Score: 100
        IRPKKCFNNITGYCRKKCKMGEIYESSCRNGKLCCVDEADNKKSKEVLHPPQLAENSNVSLDYMILPTITVSTIQ
  • 3. L12A00535|    From 1 To 75 E-value: 1e-23 Score: 100
        ARPRKCFSNITGYCRKKCQMGEIYEIACPNGKLCCVNEDKNKKYKKAPESPHSLPQPDEKIDYVILPTTTLLTVQ
  • 4. L12A00534|    From 1 To 75 E-value: 1e-23 Score: 100
        ARPRKCFSNITGYCRKKCKMGEIYEMACLNGKLCCVNEDKNKKHQKAPES-PLPLPQPKGKIDYVILPTITLLTIQ
  • 5. L12A11404|    From 4 To 77 E-value: 4e-23 Score: 98.6
        ARPRKCFSNITGYCRKKCQMGEIYEIACPNGKLCCVNEDKNKKYKKAPESPHSLPQPDEKIDYVILPTTTLLTV

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Staphylococcus aureus ATCC 25923  MIC:  4 μM  ( )  
  •   2  Target:  Bacillus subtilis KCTC 1998  MIC:  4 μM  ( )  
  •   3  Target:  Listeria monocytogenes KCTC 3710  MIC:  8 μM  ( )  
  •   4  Target:  Escherichia coli ATCC 25922  MIC:  2 μM  ( )  
  •   5  Target:  Pseudomonas aeruginosa ATCC 27853  MIC:  4 μM  ( )  
  •   6  Target:  Salmonella typhimurium KCTC 1926  MIC:  4 μM  ( )  
  •   7  Target:  Candida albicans KCTC 7270  MIC:  16 μM  ( )  
  •   8  Target:  Trichosporon beigelii KCTC 7707  MIC:  16 μM  ( )  
  •   9  Target:  Staphylococcus aureus CCARM 3518  MIC:  4 μM  ( )  
  •   10  Target:  Staphylococcus aureus CCARM 3090  MIC:  4 μM  ( )  
  •   11  Target:  Escherichia coli CCARM 1229  MIC:  2 μM  ( )  
  •   12  Target:  Escherichia coli CCARM 1238  MIC:  2 μM  ( )  
  •   13  Target:  Pseudomonas aeruginosa 4007  MIC:  4 μM  ( )  
  •   14  Target:  Pseudomonas aeruginosa 4891  MIC:  8 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: