Record in detail


General Info

  • lamp_id:L12A011912
  • Name:
  • FullName:
  • Source:
  • Mass:5863.8 Da
  • Sequence Length:52 aa
  • Isoelectric Point:8.87
  • Activity:Antimicrobial
  • Sequence
        VSGSTEKCWNLHGKCRDTCSRNEKIYVFCLSGKLCCVKPKFQPNTSPQLINT
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A11912|    From 1 To 52 E-value: 2e-26 Score: 109
        VSGSTEKCWNLHGKCRDTCSRNEKIYVFCLSGKLCCVKPKFQPNTSPQLINT
  • 2. L12A08242|    From 18 To 69 E-value: 2e-25 Score: 105
        IPGSTEKCWKLHGKCRDTCSRNEKIYVFCLSGKLCCVKPKFQPNTSPQLINT
  • 3. L12A08353|    From 18 To 69 E-value: 5e-24 Score: 101
        IPGSTEKCWNLHGHCRDTCSRNEKVFVFCLSGKLCCVKPKFQPNTSPRLINA
  • 4. L12A11195|    From 1 To 46 E-value: 3e-18 Score: 82.4
        SPEKCWNLHGSCRDKCSKNEKVYVFCVSGKLCCVKPKFQPNLFPKV
  • 5. L12A08241|    From 18 To 66 E-value: 7e-18 Score: 80.9
        IADSTEDCWNLHGNCRDRCHKNEKVYVLCLSGKLCCVKPKYQPHGLPKL

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli ATCC 25922  MIC:  2.5-5 μM  ( )  
  •   2  Target:  Pseudomonas aeruginosa ATCC 27853  MIC:  20 μM  ( )  
  •   3  Target:  Enterobacter cloacae ATCC 49141  MIC:  80 μM  ( )  
  •   4  Target:  Enterobacter aerogenes ATCC 35029  MIC:  80 μM  ( )  
  •   5  Target:  Staphylococcus aureus ATCC 6538P  MIC:  80 μM  ( )  
  •   6  Target:  Enterococcus faecalis ATCC 19433  MIC:  80 μM  ( )  
  •   7  Target:  Bacillus megaterium Bm11  MIC:  2.5 μM  ( )  
  •   8  Target:  Streptococcus pyogenes ATCC 49399  MIC:  2.5 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: