Record in detail


General Info

  • lamp_id:L12A011957
  • Name:
  • FullName:
  • Source:
  • Mass:4996.8 Da
  • Sequence Length:44 aa
  • Isoelectric Point:9.51
  • Activity:Antimicrobial
  • Sequence
        VVHAPRRIARMTPLWRIMNSKPFGAYCQNNYECSTGLCRAGHCS
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A11957|    From 1 To 44 E-value: 2e-22 Score: 95.9
        VVHAPRRIARMTPLWRIMNSKPFGAYCQNNYECSTGLCRAGHCS
  • 2. L12A06015|    From 2 To 40 E-value: 2e-19 Score: 86.3
        RRIARMTPLWRIMNSKPFGAYCQNNYECSTGLCRAGHCS
  • 3. L01A004009    From 1 To 39 E-value: 8e-19 Score: 84
        RRVARMTPLWRIMSSKPFGAYCQNNYECSTGLCRAGHCS
  • 4. L12A07803|    From 49 To 87 E-value: 4e-17 Score: 78.6
        RRMARMTPLWRIMGTKPHGAYCQNNYECSTGICRKGHCS
  • 5. L01A003990    From 28 To 71 E-value: 4e-17 Score: 78.6
        VQRSLRRMARMTPLWRIMGTKPHGAYCQNNYECSTGICRKGHCS

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Bacillus cereus  MEC:  1.8 μg/ml  ( )  
  •   2  Target:  Staphylococcus aureus RM4220  MEC:  1.37 μg/ml  ( )  
  •   3  Target:  Streptococcus iniae FP5229  MEC:  1.79 μg/ml  ( )  
  •   4  Target:  Streptococcus mutans  MEC:  1.7 μg/ml  ( )  
  •   5  Target:  Pseudomonas aeruginosa KCTC 2004  MEC:  1.92 μg/ml  ( )  
  •   6  Target:  Vibrio anguillarum  :  >125 μg/ml  ( )  
  •   7  Target:  Vibrio harveyi KCCM 40866  MEC:  >125 μg/ml  ( )  
  •   8  Target:  Candida albicans KCTC 7965  MEC:  2.16 μg/ml  ( )  
  •   9  Target:  Human cervical carcinoma HeLa  95-99% Kil:  25-50 μg/ml  ( )  
  •   10  Target:  Human lung carcinoma A549  97-99% Kil:  25-50 μg/ml  ( )  
  •   11  Target:  Human colon adenocarcinoma HCT 116  92-94% Kil:  25-50 μg/ml  ( )  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: