Record in detail
General Info
- lamp_id:L12A011957
- Name:
- FullName:
- Source:
- Mass:4996.8 Da
- Sequence Length:44 aa
- Isoelectric Point:9.51
- Activity:Antimicrobial
- Sequence
VVHAPRRIARMTPLWRIMNSKPFGAYCQNNYECSTGLCRAGHCS - Function:
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ2362
- 2 Database:dbAMP dbAMP_11957
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L12A11957| From 1 To 44 E-value: 2e-22 Score: 95.9
VVHAPRRIARMTPLWRIMNSKPFGAYCQNNYECSTGLCRAGHCS - 2. L12A06015| From 2 To 40 E-value: 2e-19 Score: 86.3
RRIARMTPLWRIMNSKPFGAYCQNNYECSTGLCRAGHCS - 3. L01A004009 From 1 To 39 E-value: 8e-19 Score: 84
RRVARMTPLWRIMSSKPFGAYCQNNYECSTGLCRAGHCS - 4. L12A07803| From 49 To 87 E-value: 4e-17 Score: 78.6
RRMARMTPLWRIMGTKPHGAYCQNNYECSTGICRKGHCS - 5. L01A003990 From 28 To 71 E-value: 4e-17 Score: 78.6
VQRSLRRMARMTPLWRIMGTKPHGAYCQNNYECSTGICRKGHCS
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
- 1 Target: Bacillus cereus MEC: 1.8 μg/ml ( )
- 2 Target: Staphylococcus aureus RM4220 MEC: 1.37 μg/ml ( )
- 3 Target: Streptococcus iniae FP5229 MEC: 1.79 μg/ml ( )
- 4 Target: Streptococcus mutans MEC: 1.7 μg/ml ( )
- 5 Target: Pseudomonas aeruginosa KCTC 2004 MEC: 1.92 μg/ml ( )
- 6 Target: Vibrio anguillarum : >125 μg/ml ( )
- 7 Target: Vibrio harveyi KCCM 40866 MEC: >125 μg/ml ( )
- 8 Target: Candida albicans KCTC 7965 MEC: 2.16 μg/ml ( )
- 9 Target: Human cervical carcinoma HeLa 95-99% Kil: 25-50 μg/ml ( )
- 10 Target: Human lung carcinoma A549 97-99% Kil: 25-50 μg/ml ( )
- 11 Target: Human colon adenocarcinoma HCT 116 92-94% Kil: 25-50 μg/ml ( )
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
No references found on LAMP database
Comments
- Comments
No comments found on LAMP database