Record in detail


General Info

  • lamp_id:L12A012118
  • Name:
  • FullName:
  • Source:
  • Mass:3808.5 Da
  • Sequence Length:36 aa
  • Isoelectric Point:9.1
  • Activity:Antimicrobial
  • Sequence
        WSGFTQGVGNPVSCVRNKGICVPIRCPGNMKQIGTC
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A12118|    From 1 To 36 E-value: 5e-16 Score: 74.7
        WSGFTQGVGNPVSCVRNKGICVPIRCPGNMKQIGTC
  • 2. L01A001447    From 18 To 53 E-value: 7e-16 Score: 74.3
        WSGFTQGVGNPVSCVRNKGICVPIRCPGSMKQIGTC
  • 3. L12A09081|    From 18 To 53 E-value: 0.00000000000001 Score: 70.5
        WSGFTQGVGNPLSCGRNKGICVPIRCPGKMKQIGTC
  • 4. L12A04056|    From 2 To 36 E-value: 0.00000000000009 Score: 67.4
        SGFTQGVGNPVSCARNKGICVPSRCPGNMRQIGTC
  • 5. L12A09074|    From 19 To 53 E-value: 0.000000000002 Score: 63.2
        SGFTQGISNPLSCRRNKGICLPIRCPGSMRQIGTC

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli ATCC 25922  MIC:  8 μM  ( )  
  •   2  Target:  Escherichia coli UB1005  MIC:  8 μM  ( )  
  •   3  Target:  Pseudomonas aeruginosa ATCC 27853  MIC:  16 μM  ( )  
  •   4  Target:  Salmonella typhimurium ATCC 7731  MIC:  64 μM  ( )  
  •   5  Target:  Salmonella pullorum C79-13  MIC:  8 μM  ( )  
  •   6  Target:  Staphylococcus aureus ATCC 29213  MIC:  16 μM  ( )  
  •   7  Target:  Staphylococcus aureus ATCC 43300  MIC:  32 μM  ( )  
  •   8  Target:  Staphylococcus epidermidis ATCC 12228  MIC:  32 μM  ( )  
  •   9  Target:  Enterococcus faecalis ATCC 29212  MIC:  32 μM  ( )  
  •   10  Target:  Bacillus subtilis CMCC 63501  MIC:  16 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: