Record in detail
General Info
- lamp_id:L12A012179
- Name:
- FullName:
- Source:
- Mass:4286.8 Da
- Sequence Length:40 aa
- Isoelectric Point:5.54
- Activity:Antimicrobial
- Sequence
YDNGIYCNNSKCWVNWGEAKENIAGIVISGWASGLAGMGH - Function:
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ6792
- 2 Database:dbAMP dbAMP_12179
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L12A09064| From 32 To 71 E-value: 4e-19 Score: 85.1
YDNGIYCNNSKCWVNWGEAKENIAGIVISGWASGLAGMGH - 2. L12A09477| From 15 To 54 E-value: 1e-18 Score: 83.6
YDNGIYCNNSKCWVNWGEAKENIAGIVISGWASGLAGMGH - 3. L12A05605| From 25 To 64 E-value: 2e-18 Score: 82.4
YDNGIYCNNSKCWFNWGEAKENIAGIVISGWASGLAGMGH - 4. L12A00673| From 5 To 44 E-value: 2e-18 Score: 82.4
YDNGIYCNNSKCWVNWGEAKENIAGIVISGWASGLAGMGH - 5. L12A12179| From 1 To 40 E-value: 4e-18 Score: 81.6
YDNGIYCNNSKCWVNWGEAKENIAGIVISGWASGLAGMGH
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
- 1 Target: Aspergillus flavus KCTC 6905 MIC: 2 μM ( )
- 2 Target: Colletotrichum gloeosporioides KCTC 6169 MIC: 1 μM ( )
- 3 Target: Candida albicans KCTC 7270 MIC: 8 μM ( )
- 4 Target: Candida albicans CCARM 14001 MIC: 8 μM ( )
- 5 Target: Candida albicans CCARM 14004 MIC: 8 μM ( )
- 6 Target: Candida albicans CCARM 14007 MIC: 8 μM ( )
- 7 Target: Candida albicans CCARM 14020 MIC: 8 μM ( )
- 8 Target: Candida krusei CCARM 14017 MIC: 4 μM ( )
- 9 Target: Candida parapsilosis CCARM 14016 MIC: 8 μM ( )
- 10 Target: Fusarium graminearum KCTC 16656 MIC: 4 μM ( )
- 11 Target: Fusarium moniliforme KCTC 6149 MIC: 2 μM ( )
- 12 Target: Fusarium oxysporum KCTC 16909 MIC: 2 μM ( )
- 13 Target: Fusarium solani KCTC 6326 MIC: 1 μM ( )
- 14 Target: Trichophyton rubrum KCTC 6345 MIC: 2 μM ( )
- 15 Target: Trichoderma virens KCTC 16924 MIC: 4 μM ( )
- 16 Target: Trichoderma viride KCTC 16992 MIC: 1 μM ( )
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
No references found on LAMP database
Comments
- Comments
No comments found on LAMP database