Record in detail


General Info

  • lamp_id:L12A012186
  • Name:
  • FullName:
  • Source:
  • Mass:11106.6 Da
  • Sequence Length:95 aa
  • Isoelectric Point:10.77
  • Activity:AntiGram_p,AntiGram_n,Antifungal,Antimicrobial
  • Sequence
        YEALVTSILGKLTGLWHNDSVDFMGHICYFRRRPKIRRFKLYHEGKFWCPGWAPFEGRSRTKSRSGSSREATKDFVRKALQNGLVTQQDASLWLN
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A10327|    From 2 To 96 E-value: 0 Score: 201
        YEALVTSILGKLTGLWHNDSVDFMGHICYFRRRPKIRRFKLYHEGKFWCPGWAPFEGRSRTKSRSGSSREATKDFVRKALQNGLVTQQDASLWLN
  • 2. L12A12186|    From 1 To 95 E-value: 0 Score: 200
        YEALVTSILGKLTGLWHNDSVDFMGHICYFRRRPKIRRFKLYHEGKFWCPGWAPFEGRSRTKSRSGSSREATKDFVRKALQNGLVTQQDASLWLN
  • 3. L12A12192|    From 1 To 95 E-value: 0 Score: 184
        YETLIASVLGKLTGLWHNNSVDFMGHTCHFRRRPKVRKFKLYHEGKFWCPGWAPFEGRSRTKSRSGSSREAIKDFVRKALQNGLITQQDATVWVN
  • 4. L12A10325|    From 2 To 95 E-value: 3.00004e-41 Score: 158
        YEALVASILGKLSGLWHSDTVDFMGHTCHIRRKPKFRKFKLYHEGKFWCPGWTHLEGNSRTKSRSGSTREATKDFVHKALQNKLITKNSADAWL
  • 5. L12A10326|    From 2 To 95 E-value: 8.00001e-41 Score: 157
        YEALVASILGKLSGLWHSDTVDFMGHTCHIRRRPKFRKFKLYHEGKFWCPGWTHLEGNSRTKSRSGSARDAIKDFVYKALQNKLITENNAAAWL

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Staphylococcus aureus NCTC 10788  MIC:  >512 μM  ( )  
  •   2  Target:  Staphylococcus aureus NCTC 10788  MBC:  >512 μM  ( )  
  •   3  Target:  Staphylococcus aureus ATCC 12493  MIC:  >512 μM  ( )  
  •   4  Target:  Staphylococcus aureus ATCC 12493  MBC:  >512 μM  ( )  
  •   5  Target:  Escherichia coli NCTC 10418  MIC:  512 μM  ( )  
  •   6  Target:  Escherichia coli NCTC 10418  MBC:  >512 μM  ( )  
  •   7  Target:  Enterococcus faecalis NCTC 12697  MIC:  >512 μM  ( )  
  •   8  Target:  Enterococcus faecalis NCTC 12697  MBC:  >512 μM  ( )  
  •   9  Target:  Pseudomonas aeruginosa ATCC 27853  MIC:  >512 μM  ( )  
  •   10  Target:  Pseudomonas aeruginosa ATCC 27853  MBC:  >512 μM  ( )  
  •   11  Target:  Candida albicans NCTC 1467  MIC:  >512 μM  ( )  
  •   12  Target:  Candida albicans NCTC 1467  MBC:  >512 μM  ( )  
  •   13  Target:  Human prostate adenocarcinoma PC-3  IC50:  792.60 μM  ( )  
  •   14  Target:  Human squamous lung carcinoma NCI-H157  IC50:  58.18 μM  ( )  
  •   15  Target:  Human breast adenocarcinoma MDA-MB-435  IC50:  179.00 μM  ( )  
  •   16  Target:  Human glioblastoma U251-MG  IC50:  278.30 μM  ( )  
  •   17  Target:  Human breast adenocarcinoma MCF-7  IC50:  316.90 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: