Record in detail


General Info

  • lamp_id:L12A012189
  • Name:
  • FullName:
  • Source:
  • Mass:4856.6 Da
  • Sequence Length:43 aa
  • Isoelectric Point:7.96
  • Activity:Antimicrobial
  • Sequence
        YEEVPVESWKMPYNNRLKRSAAGCKFCCGCCPDMNGCGVCCRF
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A12189|    From 1 To 43 E-value: 8e-21 Score: 90.9
        YEEVPVESWKMPYNNRLKRSAAGCKFCCGCCPDMNGCGVCCRF
  • 2. L12A08269|    From 46 To 88 E-value: 2e-17 Score: 79.3
        HEEMPEESWKMPYNNRHKRSPAGCRFCCGCCPNMIGCGVCCRF
  • 3. L12A08273|    From 46 To 88 E-value: 2e-16 Score: 75.9
        HEEKSEESWKMPYNNRHKRSPAGCRFCCGCCPNMRGCGVCCRF
  • 4. L03A000171    From 41 To 85 E-value: 8e-16 Score: 74.3
        YQEMPVESWKMPYNNRHKRHSSPGGCRFCCNCCPNMSGCGVCCRF
  • 5. L12A08274|    From 46 To 88 E-value: 8e-16 Score: 73.9
        HEEKSEESWKMPYNNRHKRSPKDCQFCCGCCPDMSGCGICCRF

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli  MIC:  >100 μM  ( )  
  •   2  Target:  Pseudomonas aeruginosa ATCC 27853  MIC:  >100 μM  ( )  
  •   3  Target:  Salmonella enterica ATCC 14028  MIC:  >100 μM  ( )  
  •   4  Target:  Klebsiella pneumoniae ATCC 13883  MIC:  >100 μM  ( )  
  •   5  Target:  Bacillus subtilis  MIC:  >100 μM  ( )  
  •   6  Target:  Staphylococcus aureus ATCC 25923  MIC:  >100 μM  ( )  
  •   7  Target:  Streptococcus pyogenes ATCC 19615  MIC:  >100 μM  ( )  
  •   8  Target:  Enterococcus faecalis ATCC 29212  MIC:  >100 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: