Record in detail


General Info

  • lamp_id:L12A012205
  • Name:
  • FullName:
  • Source:
  • Mass:9613 Da
  • Sequence Length:92 aa
  • Isoelectric Point:7.04
  • Activity:Antimicrobial
  • Sequence
        YKNSLALPTLEKDVITPEALEAVLKSNGGAIVNIKTIVSNTIFEEALLNNANHGLGGTIPCGESCVFIPCLTSAIGCSCKSKVCYKNSLALN
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A12205|    From 1 To 92 E-value: 0 Score: 182
        YKNSLALPTLEKDVITPEALEAVLKSNGGAIVNIKTIVSNTIFEEALLNNANHGLGGTIPCGESCVFIPCLTSAIGCSCKSKVCYKNSLALN
  • 2. L12A11674|    From 3 To 94 E-value: 0 Score: 179
        YKNSLALPTLEKDVITPEALEAVLKSNGGATVNIKTIVSNTIFEEALLNNANHGLGGTIPCGESCVFIPCLTSAIGCSCKSKVCYKNSLALN
  • 3. L12A11674|    From 1 To 9 E-value: 4.6 Score: 21.6
        VCYKNSLAL
  • 4. L12A05611|    From 1 To 98 E-value: 3e-22 Score: 95.5
        LATFERDVITPETVHAILKKTNSNSNIMLHEDAIQALTGKTLISKTVLEEALLKNAENGLVGSGVPCGESCVWIPCLTSIVGCSCKNNVCTLNSLAQN
  • 5. L12A05610|    From 1 To 93 E-value: 2e-21 Score: 92.4
        LATFEKDVITAETIQAVIKRTAPLSNIMLEGDAINALLTSKTVISKTVLEEAFLKT--DATNGVIPCGESCVFIPCISSVLGCSCKNKVCYRNSL

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Human skin melanoma MM96L  -:  NA -  ( )  
  •   2  Target:  Human cervical carcinoma HeLa  -:  NA -  ( )  
  •   3  Target:  Human myelogenous leukemia K562  -:  NA -  ( )  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: