Record in detail


General Info

  • lamp_id:L12A012207
  • Name:
  • FullName:
  • Source:
  • Mass:5117.1 Da
  • Sequence Length:43 aa
  • Isoelectric Point:10.32
  • Activity:Antimicrobial
  • Sequence
        YKQCHKKGGHCFPKEKICIPPSSDFGKMDCRWRWKCCKKRSGK
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A02180|    From 9 To 51 E-value: 2e-20 Score: 89
        YKQCHKKGGHCFPKEKICIPPSSDFGKMDCRWRWKCCKKRSGK
  • 2. L12A12207|    From 1 To 43 E-value: 4e-20 Score: 88.2
        YKQCHKKGGHCFPKEKICIPPSSDFGKMDCRWRWKCCKKRSGK
  • 3. L02A001650    From 1 To 42 E-value: 9e-19 Score: 84
        YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG
  • 4. L12A07925|    From 23 To 63 E-value: 3e-17 Score: 79
        YKRCHKKGGHCFPKTVICLPPSSDFGKMDCRWRWKCCKKGS
  • 5. L12A12214|    From 1 To 41 E-value: 4e-17 Score: 78.2
        YKRCHKKGGHCFPKEKICTPPSSDFGKMDCRWKWKCCKKGS

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli  MIC:  40 μM  ( )  
  •   2  Target:  Pseudomonas aeruginosa ATCC 27853  MIC:  40 μM  ( )  
  •   3  Target:  Salmonella enterica ATCC 14028  MIC:  40 μM  ( )  
  •   4  Target:  Klebsiella pneumoniae ATCC 13883  MIC:  40 μM  ( )  
  •   5  Target:  Bacillus subtilis  MIC:  40 μM  ( )  
  •   6  Target:  Staphylococcus aureus ATCC 25923  MIC:  30 μM  ( )  
  •   7  Target:  Streptococcus pyogenes ATCC 19615  MIC:  70 μM  ( )  
  •   8  Target:  Enterococcus faecalis ATCC 29212  MIC:  30 μM  ( )  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: