Record in detail


General Info

  • lamp_id:L12A012209
  • Name:
  • FullName:
  • Source:
  • Mass:4813.7 Da
  • Sequence Length:42 aa
  • Isoelectric Point:9.9
  • Activity:Antimicrobial
  • Sequence
        YKRCHIKGGHCFPKEKICIPPSSDFGKMDCPWRRKCCKKGSG
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A07924|    From 23 To 64 E-value: 2e-20 Score: 89.7
        YKRCHIKGGHCFPKEKICIPPSSDFGKMDCPWRRKCCKKGSG
  • 2. L12A12209|    From 1 To 42 E-value: 1e-19 Score: 86.7
        YKRCHIKGGHCFPKEKICIPPSSDFGKMDCPWRRKCCKKGSG
  • 3. L12A12211|    From 1 To 42 E-value: 9e-19 Score: 84
        YKRCHIKGGHCFPKGKICIPPSSDFGKMDCPWRRKCCKKGSG
  • 4. L12A12210|    From 1 To 42 E-value: 2e-18 Score: 82.8
        YKRCHIKGGHCFPKEKICIPPSSDFGKMDCPWRRKSLKKGSG
  • 5. L02A001650    From 1 To 42 E-value: 2e-16 Score: 76.6
        YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli ATCC 35218  MIC:  >30 μM  ( )  
  •   2  Target:  Klebsiella oxytoca ATCC 13182  MIC:  >30 μM  ( )  
  •   3  Target:  Klebsiella pneumoniae ATCC 700603  MIC:  >30 μM  ( )  
  •   4  Target:  Serratia marcescens ATCC 13880  MIC:  >30 μM  ( )  
  •   5  Target:  Staphylococcus aureus ATCC 80958  MIC:  >30 μM  ( )  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: