Record in detail


General Info

  • lamp_id:L12A012210
  • Name:
  • FullName:
  • Source:
  • Mass:4807.7 Da
  • Sequence Length:42 aa
  • Isoelectric Point:10.42
  • Activity:Antimicrobial
  • Sequence
        YKRCHIKGGHCFPKEKICIPPSSDFGKMDCPWRRKSLKKGSG
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A12210|    From 1 To 42 E-value: 7e-20 Score: 87.4
        YKRCHIKGGHCFPKEKICIPPSSDFGKMDCPWRRKSLKKGSG
  • 2. L12A07924|    From 23 To 64 E-value: 1e-18 Score: 83.6
        YKRCHIKGGHCFPKEKICIPPSSDFGKMDCPWRRKCCKKGSG
  • 3. L12A12209|    From 1 To 42 E-value: 2e-18 Score: 82.8
        YKRCHIKGGHCFPKEKICIPPSSDFGKMDCPWRRKCCKKGSG
  • 4. L12A12211|    From 1 To 42 E-value: 1e-17 Score: 80.1
        YKRCHIKGGHCFPKGKICIPPSSDFGKMDCPWRRKCCKKGSG
  • 5. L02A001650    From 1 To 42 E-value: 0.000000000000003 Score: 72.4
        YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Human skin melanoma MM96L  -:  NA -  ( )  
  •   2  Target:  Human cervical carcinoma HeLa  -:  NA -  ( )  
  •   3  Target:  Human myelogenous leukemia K562  -:  NA -  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: