Record in detail


General Info

  • lamp_id:L12A012211
  • Name:
  • FullName:
  • Source:
  • Mass:4741.7 Da
  • Sequence Length:42 aa
  • Isoelectric Point:10.19
  • Activity:Antimicrobial
  • Sequence
        YKRCHIKGGHCFPKGKICIPPSSDFGKMDCPWRRKCCKKGSG
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A12211|    From 1 To 42 E-value: 2e-19 Score: 85.9
        YKRCHIKGGHCFPKGKICIPPSSDFGKMDCPWRRKCCKKGSG
  • 2. L12A07924|    From 23 To 64 E-value: 4e-19 Score: 85.1
        YKRCHIKGGHCFPKEKICIPPSSDFGKMDCPWRRKCCKKGSG
  • 3. L12A12209|    From 1 To 42 E-value: 9e-19 Score: 84
        YKRCHIKGGHCFPKEKICIPPSSDFGKMDCPWRRKCCKKGSG
  • 4. L12A12210|    From 1 To 42 E-value: 1e-17 Score: 80.1
        YKRCHIKGGHCFPKEKICIPPSSDFGKMDCPWRRKSLKKGSG
  • 5. L02A001650    From 1 To 42 E-value: 0.000000000000001 Score: 73.6
        YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Human skin melanoma MM96L  50% Cell d:  12.2±0.6 μM  ( )  
  •   2  Target:  Human cervical carcinoma HeLa  50% Cell d:  9.8±0.5 μM  ( )  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: