Record in detail
General Info
- lamp_id:L12A012214
- Name:
- FullName:
- Source:
- Mass:5034 Da
- Sequence Length:43 aa
- Isoelectric Point:10.1
- Activity:Antimicrobial
- Sequence
YKRCHKKGGHCFPKEKICTPPSSDFGKMDCRWKWKCCKKGSVN - Function:
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ7564
- 2 Database:dbAMP dbAMP_12214
- 3 Database:DRAMP DRAMP04709
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L12A12214| From 1 To 43 E-value: 2e-20 Score: 89
YKRCHKKGGHCFPKEKICTPPSSDFGKMDCRWKWKCCKKGSVN - 2. L12A07925| From 23 To 65 E-value: 3e-19 Score: 85.1
YKRCHKKGGHCFPKTVICLPPSSDFGKMDCRWRWKCCKKGSVN - 3. L12A12216| From 1 To 43 E-value: 5e-19 Score: 84.7
YKRCHKKGGHCFPKTVICLPPSSDFGKMDCRWKWKCCKKGSVN - 4. L12A12217| From 1 To 43 E-value: 7e-19 Score: 84.3
YKRCHKKGGHCFPKTVICLPPSSDFGKMDCRWRWKCCKKGSVN - 5. L12A12215| From 1 To 43 E-value: 7e-19 Score: 84.3
YKRCHKKGGHCFPKTVICLPPSSDFGKMDCRWKWKCCKKGSVN
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
- 1 Target: Staphylococcus aureus ATCC 25923 MIC50: 4.4 μM ( )
- 2 Target: Staphylococcus aureus ATCC 25923 MBC: 35 μM ( )
- 3 Target: Bacillus subtilis ATCC 6633 -: NA - ( )
- 4 Target: Klebsiella pneumoniae ATCC 10031 -: NA - ( )
- 5 Target: Escherichia coli ATCC 8739 MIC50: 140 μM ( )
- 6 Target: Candida albicans ATCC 10231 MIC50: 2.2 μM ( )
- 7 Target: Candida albicans ATCC 10231 MIC90: 4.4 μM ( )
- 8 Target: Candida tropicalis MIC50: 17.5 μM ( )
- 9 Target: Candida tropicalis MIC90: >280 μM ( )
- 10 Target: Candida parapsilosis ATCC 22019 MIC50: 2.2 μM ( )
- 11 Target: Candida parapsilosis ATCC 22019 MIC90: 2.2 μM ( )
- 12 Target: Candida krusei ATCC 6258 MIC50: 2.2 μM ( )
- 13 Target: Candida krusei ATCC 6258 MIC90: >280 μM ( )
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
No references found on LAMP database
Comments
- Comments
No comments found on LAMP database