Record in detail


General Info

  • lamp_id:L12A012214
  • Name:
  • FullName:
  • Source:
  • Mass:5034 Da
  • Sequence Length:43 aa
  • Isoelectric Point:10.1
  • Activity:Antimicrobial
  • Sequence
        YKRCHKKGGHCFPKEKICTPPSSDFGKMDCRWKWKCCKKGSVN
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A12214|    From 1 To 43 E-value: 2e-20 Score: 89
        YKRCHKKGGHCFPKEKICTPPSSDFGKMDCRWKWKCCKKGSVN
  • 2. L12A07925|    From 23 To 65 E-value: 3e-19 Score: 85.1
        YKRCHKKGGHCFPKTVICLPPSSDFGKMDCRWRWKCCKKGSVN
  • 3. L12A12216|    From 1 To 43 E-value: 5e-19 Score: 84.7
        YKRCHKKGGHCFPKTVICLPPSSDFGKMDCRWKWKCCKKGSVN
  • 4. L12A12217|    From 1 To 43 E-value: 7e-19 Score: 84.3
        YKRCHKKGGHCFPKTVICLPPSSDFGKMDCRWRWKCCKKGSVN
  • 5. L12A12215|    From 1 To 43 E-value: 7e-19 Score: 84.3
        YKRCHKKGGHCFPKTVICLPPSSDFGKMDCRWKWKCCKKGSVN

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Staphylococcus aureus ATCC 25923  MIC50:  4.4 μM  ( )  
  •   2  Target:  Staphylococcus aureus ATCC 25923  MBC:  35 μM  ( )  
  •   3  Target:  Bacillus subtilis ATCC 6633  -:  NA -  ( )  
  •   4  Target:  Klebsiella pneumoniae ATCC 10031  -:  NA -  ( )  
  •   5  Target:  Escherichia coli ATCC 8739  MIC50:  140 μM  ( )  
  •   6  Target:  Candida albicans ATCC 10231  MIC50:  2.2 μM  ( )  
  •   7  Target:  Candida albicans ATCC 10231  MIC90:  4.4 μM  ( )  
  •   8  Target:  Candida tropicalis  MIC50:  17.5 μM  ( )  
  •   9  Target:  Candida tropicalis  MIC90:  >280 μM  ( )  
  •   10  Target:  Candida parapsilosis ATCC 22019  MIC50:  2.2 μM  ( )  
  •   11  Target:  Candida parapsilosis ATCC 22019  MIC90:  2.2 μM  ( )  
  •   12  Target:  Candida krusei ATCC 6258  MIC50:  2.2 μM  ( )  
  •   13  Target:  Candida krusei ATCC 6258  MIC90:  >280 μM  ( )  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: