Record in detail


General Info

  • lamp_id:L12A012215
  • Name:
  • FullName:
  • Source:
  • Mass:5174.1 Da
  • Sequence Length:45 aa
  • Isoelectric Point:10.14
  • Activity:Antimicrobial
  • Sequence
        YKRCHKKGGHCFPKTVICLPPSSDFGKMDCRWKWKCCKKGSVNNA
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A07925|    From 23 To 67 E-value: 3e-22 Score: 95.5
        YKRCHKKGGHCFPKTVICLPPSSDFGKMDCRWRWKCCKKGSVNNA
  • 2. L12A12216|    From 1 To 45 E-value: 4e-22 Score: 95.1
        YKRCHKKGGHCFPKTVICLPPSSDFGKMDCRWKWKCCKKGSVNNA
  • 3. L12A12215|    From 1 To 45 E-value: 5e-22 Score: 94.7
        YKRCHKKGGHCFPKTVICLPPSSDFGKMDCRWKWKCCKKGSVNNA
  • 4. L12A12217|    From 1 To 45 E-value: 6e-22 Score: 94.4
        YKRCHKKGGHCFPKTVICLPPSSDFGKMDCRWRWKCCKKGSVNNA
  • 5. L12A12213|    From 1 To 45 E-value: 3e-21 Score: 92.4
        YKRCHKKEGHCFPKTVICLPPSSDFGKMDCRWKWKCCKKGSVNNA

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli ATCC 35218  MIC:  7.35 μM  ( )  
  •   2  Target:  Klebsiella oxytoca ATCC 13182  MIC:  1.84 μM  ( )  
  •   3  Target:  Klebsiella pneumoniae ATCC 700603  MIC:  3.67 μM  ( )  
  •   4  Target:  Serratia marcescens ATCC 13880  MIC:  1.84 μM  ( )  
  •   5  Target:  Klebsiella pneumoniae KPC 001825971  MIC:  25.6 μM  ( )  
  •   6  Target:  Staphylococcus aureus ATCC 80958  MIC:  7.35 μM  ( )  
  •   7  Target:  Galleria mellonella  -:  NA -  ( )  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: