Record in detail


General Info

  • lamp_id:L12A012216
  • Name:
  • FullName:
  • Source:
  • Mass:5487.5 Da
  • Sequence Length:48 aa
  • Isoelectric Point:10.14
  • Activity:Antimicrobial
  • Sequence
        YKRCHKKGGHCFPKTVICLPPSSDFGKMDCRWKWKCCKKGSVNNAISI
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A07925|    From 23 To 70 E-value: 7e-24 Score: 100
        YKRCHKKGGHCFPKTVICLPPSSDFGKMDCRWRWKCCKKGSVNNAISI
  • 2. L12A12216|    From 1 To 48 E-value: 9e-24 Score: 100
        YKRCHKKGGHCFPKTVICLPPSSDFGKMDCRWKWKCCKKGSVNNAISI
  • 3. L12A12217|    From 1 To 48 E-value: 1e-23 Score: 99.8
        YKRCHKKGGHCFPKTVICLPPSSDFGKMDCRWRWKCCKKGSVNNAISI
  • 4. L12A12215|    From 1 To 45 E-value: 4e-22 Score: 95.1
        YKRCHKKGGHCFPKTVICLPPSSDFGKMDCRWKWKCCKKGSVNNA
  • 5. L12A12213|    From 1 To 45 E-value: 2e-21 Score: 92.8
        YKRCHKKEGHCFPKTVICLPPSSDFGKMDCRWKWKCCKKGSVNNA

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli SBS 363  MIC:  4.6 μM  ( )  
  •   2  Target:  Escherichia coli D31  MIC:  4.6 μM  ( )  
  •   3  Target:  Pseudomonas aeruginosa ATCC 27853  MIC:  1.15 μM  ( )  
  •   4  Target:  Pseudomonas aeruginosa PA14  MIC:  4.6 μM  ( )  
  •   5  Target:  Enterobacter cloacae beta-12  MIC:  2.3 μM  ( )  
  •   6  Target:  Micrococcus luteus A270  -:  NA -  ( )  
  •   7  Target:  Staphylococcus aureus ATCC 29213  -:  NA -  ( )  
  •   8  Target:  Bacillus subtilis ATCC 6633  -:  NA -  ( )  
  •   9  Target:  Aspergillus niger  -:  NA -  ( )  
  •   10  Target:  Candida albicans MDM8  -:  NA -  ( )  
  •   11  Target:  Candida krusei IOC 4559  -:  NA -  ( )  
  •   12  Target:  Human cervical carcinoma HeLa  -:  NA -  ( )  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: