Record in detail
General Info
- lamp_id:L13A010313
- Name:
- FullName:
- Source:
- Mass:4710.2 Da
- Sequence Length:42 aa
- Isoelectric Point:4.6
- Activity:antiviral,antimicrobial
- Sequence
PPVYTKDVDISSQISSMNQSLQQSKDYIKEAQKILDTVNPSL - Function:
Cross-Linking
- Cross-linking
- 1 Database:avpdb AVP1557
- 2 Database:dbAMP dbAMP_09980
- 3 Database:SATPdb satpdb10313
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L13A010313 From 1 To 42 E-value: 2e-18 Score: 83.2
PPVYTKDVDISSQISSMNQSLQQSKDYIKEAQKILDTVNPSL - 2. L13A016389 From 2 To 36 E-value: 0.0000000000001 Score: 66.6
VDISSQISSMNQSLQQSKDYIKEAQRLLDTVNPSL - 3. L13A014321 From 1 To 36 E-value: 0.0000000000004 Score: 65.1
VYTDKVDISSQISSMNQSLQQSKDYIKEAQKILDTV - 4. L13A016604 From 1 To 23 E-value: 0.12 Score: 26.9
DLSNQINSINKSLKSAEDWIADS - 5. L01A003932 From 2 To 32 E-value: 0.3 Score: 25.8
IDISIELNKAKSDLEESKEWIRRSNQKLDSI - 6. L13A010313 From 1 To 42 E-value: 2e-18 Score: 83.2
PPVYTKDVDISSQISSMNQSLQQSKDYIKEAQKILDTVNPSL - 7. L13A016389 From 2 To 36 E-value: 0.0000000000001 Score: 66.6
VDISSQISSMNQSLQQSKDYIKEAQRLLDTVNPSL - 8. L13A014321 From 1 To 36 E-value: 0.0000000000004 Score: 65.1
VYTDKVDISSQISSMNQSLQQSKDYIKEAQKILDTV - 9. L13A016604 From 1 To 23 E-value: 0.12 Score: 26.9
DLSNQINSINKSLKSAEDWIADS - 10. L01A003932 From 2 To 32 E-value: 0.3 Score: 25.8
IDISIELNKAKSDLEESKEWIRRSNQKLDSI
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
No references found on LAMP database
Comments
- Comments
No comments found on LAMP database