Record in detail


General Info

  • lamp_id:L13A010536
  • Name:
  • FullName:
  • Source:
  • Mass:4932.9 Da
  • Sequence Length:43 aa
  • Isoelectric Point:9.47
  • Activity:antimicrobial
  • Sequence
        SALVGCWTKSYPPKPVSVDDKTCLANHLMWNIIWLNARCLMKK
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L13A010536    From 1 To 43 E-value: 7e-21 Score: 90.9
        SALVGCWTKSYPPKPVSVDDKTCLANHLMWNIIWLNARCLMKK
  • 2. L13A018405    From 1 To 15 E-value: 0.0004 Score: 35
        SALVGCWTKSYPPKP
  • 3. L02A001909    From 1 To 15 E-value: 0.0004 Score: 35
        SALVGCWTKSYPPKP
  • 4. L12A07353|    From 44 To 58 E-value: 0.001 Score: 33.9
        GALRGCWTKSYPPKP
  • 5. L02A001911    From 1 To 15 E-value: 0.001 Score: 33.5
        SALVGCWTKSYPPNP
  • 6. L13A010536    From 1 To 43 E-value: 7e-21 Score: 90.9
        SALVGCWTKSYPPKPVSVDDKTCLANHLMWNIIWLNARCLMKK
  • 7. L13A018405    From 1 To 15 E-value: 0.0004 Score: 35
        SALVGCWTKSYPPKP
  • 8. L02A001909    From 1 To 15 E-value: 0.0004 Score: 35
        SALVGCWTKSYPPKP
  • 9. L12A07353|    From 44 To 58 E-value: 0.001 Score: 33.9
        GALRGCWTKSYPPKP
  • 10. L02A001911    From 1 To 15 E-value: 0.001 Score: 33.5
        SALVGCWTKSYPPNP

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: