Record in detail


General Info

  • lamp_id:L13A010564
  • Name:
  • FullName:
  • Source:
  • Mass:5989.9 Da
  • Sequence Length:50 aa
  • Isoelectric Point:8.69
  • Activity:antimicrobial
  • Sequence
        LCLDQKPEMEPFRKDAQQALEPSRQRRWLHRRCLSGRGFCRAICSIFEEP
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:SATPdb  satpdb10564

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001642    From 1 To 50 E-value: 7e-25 Score: 104
        LCLDQKPEMEPFRKDAQQALEPSRQRRWLHRRCLSGRGFCRAICSIFEEP
  • 2. L13A010564    From 1 To 50 E-value: 1e-24 Score: 103
        LCLDQKPEMEPFRKDAQQALEPSRQRRWLHRRCLSGRGFCRAICSIFEEP
  • 3. L12A07992|    From 26 To 44 E-value: 0.15 Score: 26.6
        HCLSNRGFCRSSCKKDEQP
  • 4. L12A09492|    From 25 To 42 E-value: 0.34 Score: 25.4
        KRCWNGQGACRAYCTKYE
  • 5. L12A09491|    From 25 To 42 E-value: 0.36 Score: 25.4
        KRCWNGQGACRAYCTKYE
  • 6. L02A001642    From 1 To 50 E-value: 7e-25 Score: 104
        LCLDQKPEMEPFRKDAQQALEPSRQRRWLHRRCLSGRGFCRAICSIFEEP
  • 7. L13A010564    From 1 To 50 E-value: 1e-24 Score: 103
        LCLDQKPEMEPFRKDAQQALEPSRQRRWLHRRCLSGRGFCRAICSIFEEP
  • 8. L12A07992|    From 26 To 44 E-value: 0.15 Score: 26.6
        HCLSNRGFCRSSCKKDEQP
  • 9. L12A09492|    From 25 To 42 E-value: 0.34 Score: 25.4
        KRCWNGQGACRAYCTKYE
  • 10. L12A09491|    From 25 To 42 E-value: 0.36 Score: 25.4
        KRCWNGQGACRAYCTKYE

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: