Record in detail


General Info

  • lamp_id:L13A010619
  • Name:
  • FullName:
  • Source:
  • Mass:4219.8 Da
  • Sequence Length:37 aa
  • Isoelectric Point:4.42
  • Activity:antiviral,antimicrobial
  • Sequence
        WMEWDREIEALAKAAEALAKAAEALAKAAWASLWNWF
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L13A010619    From 1 To 37 E-value: 0.0000000000002 Score: 65.9
        WMEWDREIEALAKAAEALAKAAEALAKAAWASLWNWF
  • 2. L13A028405    From 1 To 37 E-value: 0.00000000007 Score: 57.8
        WMEWDREIEELAKKAEELAKKAEELAKKAWASLWNWF
  • 3. L13A025086    From 1 To 37 E-value: 0.00000004 Score: 48.5
        WMEWDREIEEYTKKIEEYTKKIEEYTKKIWASLWNWF
  • 4. L13A017419    From 1 To 37 E-value: 0.0000004 Score: 45.1
        WMEWDREIEEAAKKLEEAAKKLEEAAKKLWASLWNWF
  • 5. L13A012724    From 1 To 29 E-value: 0.000006 Score: 41.2
        WMEWDREIEELAKKAEELAKKAEELAKKA
  • 6. L13A010619    From 1 To 37 E-value: 0.0000000000002 Score: 65.9
        WMEWDREIEALAKAAEALAKAAEALAKAAWASLWNWF
  • 7. L13A028405    From 1 To 37 E-value: 0.00000000007 Score: 57.8
        WMEWDREIEELAKKAEELAKKAEELAKKAWASLWNWF
  • 8. L13A025086    From 1 To 37 E-value: 0.00000004 Score: 48.5
        WMEWDREIEEYTKKIEEYTKKIEEYTKKIWASLWNWF
  • 9. L13A017419    From 1 To 37 E-value: 0.0000004 Score: 45.1
        WMEWDREIEEAAKKLEEAAKKLEEAAKKLWASLWNWF
  • 10. L13A012724    From 1 To 29 E-value: 0.000006 Score: 41.2
        WMEWDREIEELAKKAEELAKKAEELAKKA

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: