Record in detail
General Info
- lamp_id:L13A010787
- Name:
- FullName:
- Source:
- Mass:4218.7 Da
- Sequence Length:36 aa
- Isoelectric Point:9.78
- Activity:antiviral,antimicrobial
- Sequence
YVSGKARGWFYRHHYESPHPRISSEVHIPLGDARLV - Function:
Cross-Linking
- Cross-linking
- 1 Database:DBAASP 5923
- 2 Database:dbAMP dbAMP_12348
- 3 Database:HIPdb HIP896
- 4 Database:SATPdb satpdb10787
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L13A010787 From 1 To 36 E-value: 2e-16 Score: 76.3
YVSGKARGWFYRHHYESPHPRISSEVHIPLGDARLV - 2. L13A016431 From 1 To 15 E-value: 0.0004 Score: 35.4
YVSGKARGWFYRHHY - 3. L13A015814 From 1 To 15 E-value: 0.002 Score: 33.1
RHHYESPHPRISSEV - 4. L13A016304 From 1 To 15 E-value: 0.003 Score: 32.3
ISSEVHIPLGDARLV - 5. L13A015230 From 1 To 15 E-value: 0.009 Score: 30.8
RHHYESTHPRISSEV - 6. L13A010787 From 1 To 36 E-value: 2e-16 Score: 76.3
YVSGKARGWFYRHHYESPHPRISSEVHIPLGDARLV - 7. L13A016431 From 1 To 15 E-value: 0.0004 Score: 35.4
YVSGKARGWFYRHHY - 8. L13A015814 From 1 To 15 E-value: 0.002 Score: 33.1
RHHYESPHPRISSEV - 9. L13A016304 From 1 To 15 E-value: 0.003 Score: 32.3
ISSEVHIPLGDARLV - 10. L13A015230 From 1 To 15 E-value: 0.009 Score: 30.8
RHHYESTHPRISSEV
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
No references found on LAMP database
Comments
- Comments
No comments found on LAMP database